BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301F10f (516 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g12220.1 68416.m01525 serine carboxypeptidase S10 family prot... 27 7.5 >At3g12220.1 68416.m01525 serine carboxypeptidase S10 family protein contains Pfam profile: PF00450 serine carboxypeptidase; similar to serine carboxypeptidase I precursor (SP:P37890) [Oryza sativa] Length = 435 Score = 27.1 bits (57), Expect = 7.5 Identities = 13/38 (34%), Positives = 22/38 (57%), Gaps = 3/38 (7%) Frame = -1 Query: 240 NNKLIEKTI---KKSNVSGYA*FILNNIHQSILPFIWT 136 NNK I+ +I KK+++ GY I + H + P++ T Sbjct: 331 NNKDIKSSIPYHKKNSIQGYRSLIFSGDHDMLTPYVGT 368 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,171,660 Number of Sequences: 28952 Number of extensions: 161850 Number of successful extensions: 218 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 215 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 218 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 937669760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -