BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301F08f (485 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22450| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_17732| Best HMM Match : RVT_1 (HMM E-Value=1.5e-27) 27 8.2 >SB_22450| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2806 Score = 27.1 bits (57), Expect = 8.2 Identities = 13/50 (26%), Positives = 27/50 (54%) Frame = -3 Query: 150 SQKRSVNNVRNFHVVLIIFVKMGKSTLDLISLNVCLHYMKNKSPILKKKK 1 S++ + +V ++ + +++ K K TLD +N+ + + PI KKK Sbjct: 1271 SKRLNRESVASYELNVVVQDKRTKRTLDRTKVNITVDDSNDNRPIFLKKK 1320 >SB_17732| Best HMM Match : RVT_1 (HMM E-Value=1.5e-27) Length = 399 Score = 27.1 bits (57), Expect = 8.2 Identities = 16/53 (30%), Positives = 28/53 (52%) Frame = -3 Query: 198 VSIIKGKLIKMF*WFISQKRSVNNVRNFHVVLIIFVKMGKSTLDLISLNVCLH 40 V I+ +L K+ WF++ K S+NN +I K + TL +I +++ H Sbjct: 232 VVIVNEELGKLTDWFLANKLSINN------FMIFRPKQKRQTLHVIKVSIGCH 278 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,211,763 Number of Sequences: 59808 Number of extensions: 185502 Number of successful extensions: 296 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 261 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 296 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1026164244 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -