BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301F08f (485 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK126604-1|BAC86609.1| 210|Homo sapiens protein ( Homo sapiens ... 30 3.8 >AK126604-1|BAC86609.1| 210|Homo sapiens protein ( Homo sapiens cDNA FLJ44641 fis, clone BRACE2030039. ). Length = 210 Score = 30.3 bits (65), Expect = 3.8 Identities = 12/49 (24%), Positives = 23/49 (46%) Frame = -2 Query: 418 LCTLFALMKTCKLVLNVCLVLIRQLWLWSLDYVYICKXXXXXVFLISIC 272 +CT++ + C V VC+V R +W V++C + + +C Sbjct: 110 VCTVWCVCMVCARVHCVCIVCARVHCVWMHGNVHVCTVCGVYAWCVHVC 158 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 51,507,667 Number of Sequences: 237096 Number of extensions: 864714 Number of successful extensions: 1129 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1097 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1129 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 4384610846 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -