BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301F08f (485 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024882-2|AAF60935.2| 344|Caenorhabditis elegans Seven tm rece... 27 5.5 U53150-2|AAV28350.1| 580|Caenorhabditis elegans Hypothetical pr... 27 7.2 >AC024882-2|AAF60935.2| 344|Caenorhabditis elegans Seven tm receptor protein 156 protein. Length = 344 Score = 27.5 bits (58), Expect = 5.5 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = -1 Query: 461 LSFNFLNGICCSECPLYFICIN 396 L FNF++G+ C LY I IN Sbjct: 91 LMFNFVSGVACFGSSLYAIAIN 112 >U53150-2|AAV28350.1| 580|Caenorhabditis elegans Hypothetical protein F20A1.4 protein. Length = 580 Score = 27.1 bits (57), Expect = 7.2 Identities = 11/47 (23%), Positives = 27/47 (57%), Gaps = 1/47 (2%) Frame = -2 Query: 457 VLIF*MESVVPNA-LCTLFALMKTCKLVLNVCLVLIRQLWLWSLDYV 320 +++ ++++P+ LC L L C +++ + ++LIR + W + V Sbjct: 175 IIVSPAKTIIPSVTLCVLNLLQNICIMMVALSILLIRNTYNWCIPTV 221 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,009,978 Number of Sequences: 27780 Number of extensions: 161483 Number of successful extensions: 278 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 277 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 278 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 903458030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -