BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301F08f (485 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 23 1.7 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 23 1.7 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 23 1.7 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 22 4.0 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 21 7.0 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 21 7.0 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 23.0 bits (47), Expect = 1.7 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +3 Query: 279 LIKKTTMIYYLQM*T*SNDHSHSCRIKTKQTFKTNL 386 +IK+T + YLQ+ D H C + K +T L Sbjct: 320 VIKRTVVSSYLQLQDLLGDFEHPCVMDCKVGVRTYL 355 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 23.0 bits (47), Expect = 1.7 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +3 Query: 279 LIKKTTMIYYLQM*T*SNDHSHSCRIKTKQTFKTNL 386 +IK+T + YLQ+ D H C + K +T L Sbjct: 235 VIKRTVVSSYLQLQDLLGDFEHPCVMDCKVGVRTYL 270 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 23.0 bits (47), Expect = 1.7 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +3 Query: 279 LIKKTTMIYYLQM*T*SNDHSHSCRIKTKQTFKTNL 386 +IK+T + YLQ+ D H C + K +T L Sbjct: 554 VIKRTVVSSYLQLQDLLGDFEHPCVMDCKVGVRTYL 589 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 21.8 bits (44), Expect = 4.0 Identities = 10/25 (40%), Positives = 15/25 (60%), Gaps = 1/25 (4%) Frame = -3 Query: 87 MGK-STLDLISLNVCLHYMKNKSPI 16 +GK ST++ N C HY+ KS + Sbjct: 560 LGKLSTIEDADKNQCRHYLDAKSSV 584 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.0 bits (42), Expect = 7.0 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = -3 Query: 201 PVSIIKGKLIKMF*WFISQKRSVN 130 PV++ KGK M WF+S++R ++ Sbjct: 580 PVTM-KGKSEPMNVWFLSRERELS 602 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.0 bits (42), Expect = 7.0 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = -3 Query: 201 PVSIIKGKLIKMF*WFISQKRSVN 130 PV++ KGK M WF+S++R ++ Sbjct: 580 PVTM-KGKSEPMNVWFLSRERELS 602 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 105,941 Number of Sequences: 438 Number of extensions: 1705 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13297932 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -