BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301F05f (384 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. 23 3.8 AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. 23 3.8 U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 22 8.9 >AY753540-1|AAV28543.1| 3320|Anopheles gambiae SGS3 protein. Length = 3320 Score = 23.0 bits (47), Expect = 3.8 Identities = 10/43 (23%), Positives = 23/43 (53%) Frame = +3 Query: 36 ASLYADEGTAFNEILAEHLYNDVIIADYDSAVERSKLIYTDNK 164 A L+ +I +H+ +DV+++++ S + S L + N+ Sbjct: 1974 APLHRHRVENIQKISGDHILSDVLLSNHQSQIITSALYSSGNE 2016 >AY753539-1|AAV28542.1| 3318|Anopheles gambiae SGS2 protein. Length = 3318 Score = 23.0 bits (47), Expect = 3.8 Identities = 10/43 (23%), Positives = 23/43 (53%) Frame = +3 Query: 36 ASLYADEGTAFNEILAEHLYNDVIIADYDSAVERSKLIYTDNK 164 A L+ +I +H+ +DV+++++ S + S L + N+ Sbjct: 1975 APLHRHRVENIQKISGDHILSDVLLSNHQSQIITSALYSSGNE 2017 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 21.8 bits (44), Expect = 8.9 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +1 Query: 223 WSTPTSSGCKAPRTSS 270 WS P+S C RT+S Sbjct: 70 WSRPSSMRCAPARTAS 85 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 363,365 Number of Sequences: 2352 Number of extensions: 6947 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 29501847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -