BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301F04f (359 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 21 4.4 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 21 4.4 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 21.0 bits (42), Expect = 4.4 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +1 Query: 79 GDPEPSKTIQKRSGHLGHYADLYGHGLSSGIA 174 GD P R+G L +YG G SG A Sbjct: 143 GDGSPGGNGGPRNGLLPLLVWIYGGGFMSGTA 174 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 21.0 bits (42), Expect = 4.4 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +1 Query: 79 GDPEPSKTIQKRSGHLGHYADLYGHGLSSGIA 174 GD P R+G L +YG G SG A Sbjct: 143 GDGSPGGNGGPRNGLLPLLVWIYGGGFMSGTA 174 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 67,958 Number of Sequences: 438 Number of extensions: 1106 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8432340 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -