BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301F03f (408 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CY... 27 0.35 AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl s... 24 2.5 AY333999-1|AAR01124.1| 268|Anopheles gambiae FBN23 protein. 22 9.9 >AY062207-1|AAL58568.1| 504|Anopheles gambiae cytochrome P450 CYP6S2 protein. Length = 504 Score = 26.6 bits (56), Expect = 0.35 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = -2 Query: 203 FWVHYNNKNNYLHWINGRSHFL 138 FW++++ + YL W+N FL Sbjct: 14 FWIYFHFRQRYLFWLNRDVPFL 35 >AJ439353-1|CAD27923.1| 1127|Anopheles gambiae putative Na-K-Cl symporter protein. Length = 1127 Score = 23.8 bits (49), Expect = 2.5 Identities = 12/39 (30%), Positives = 19/39 (48%) Frame = -3 Query: 148 LISSSRVLTKCLHTLTKYKAVLARKCLSTPSLGHYQSWL 32 LIS+ + CL + + A LA+ P+ +Y WL Sbjct: 575 LISNFFLAAYCLVNFSTFHASLAKPVGWRPTFKYYNMWL 613 >AY333999-1|AAR01124.1| 268|Anopheles gambiae FBN23 protein. Length = 268 Score = 21.8 bits (44), Expect = 9.9 Identities = 10/25 (40%), Positives = 13/25 (52%) Frame = -3 Query: 106 LTKYKAVLARKCLSTPSLGHYQSWL 32 LT +AVL R C PS + W+ Sbjct: 129 LTVSRAVLVRSCKEEPSKRTGKYWI 153 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 387,865 Number of Sequences: 2352 Number of extensions: 6050 Number of successful extensions: 6 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 32922351 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -