BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301F03f (408 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z72506-4|CAA96619.1| 590|Caenorhabditis elegans Hypothetical pr... 26 9.1 AC024785-6|AAF60605.2| 467|Caenorhabditis elegans C-type lectin... 26 9.1 >Z72506-4|CAA96619.1| 590|Caenorhabditis elegans Hypothetical protein F07A5.3 protein. Length = 590 Score = 26.2 bits (55), Expect = 9.1 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = -2 Query: 284 ITILKNKRKGKSNSITPL*IYVLDI**FWVHYNNKNNYLHWI 159 +T+L KG SI P+ I + ++ YNN + +WI Sbjct: 210 VTVLSGIFKGDGGSIVPIPIPAMPKFGYFQGYNNSRDEEYWI 251 >AC024785-6|AAF60605.2| 467|Caenorhabditis elegans C-type lectin protein 74 protein. Length = 467 Score = 26.2 bits (55), Expect = 9.1 Identities = 13/24 (54%), Positives = 18/24 (75%), Gaps = 1/24 (4%) Frame = -2 Query: 380 HASYLLALTSRHYVTDNN-RDVAL 312 HASYLL+L+ + +V NN +DV L Sbjct: 371 HASYLLSLSIQSHVPTNNVKDVEL 394 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,656,348 Number of Sequences: 27780 Number of extensions: 151304 Number of successful extensions: 254 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 252 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 254 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 651753158 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -