BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301F02f (362 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_03_0109 + 8490841-8490940,8492098-8493057,8494055-8495520 26 7.9 >05_03_0109 + 8490841-8490940,8492098-8493057,8494055-8495520 Length = 841 Score = 26.2 bits (55), Expect = 7.9 Identities = 17/36 (47%), Positives = 19/36 (52%), Gaps = 1/36 (2%) Frame = +3 Query: 111 NNYYHEEFYNDNVIFDYVD-NGSHPKNINPLTVLAK 215 N+Y E D V +DYV NG PK P TVL K Sbjct: 646 NSYIRPEQMTDEV-WDYVFCNGPAPKTSIPSTVLTK 680 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,828,294 Number of Sequences: 37544 Number of extensions: 131448 Number of successful extensions: 231 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 230 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 231 length of database: 14,793,348 effective HSP length: 73 effective length of database: 12,052,636 effective search space used: 566473892 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -