Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ovS301F02f
         (362 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

05_03_0109 + 8490841-8490940,8492098-8493057,8494055-8495520           26   7.9  

>05_03_0109 + 8490841-8490940,8492098-8493057,8494055-8495520
          Length = 841

 Score = 26.2 bits (55), Expect = 7.9
 Identities = 17/36 (47%), Positives = 19/36 (52%), Gaps = 1/36 (2%)
 Frame = +3

Query: 111 NNYYHEEFYNDNVIFDYVD-NGSHPKNINPLTVLAK 215
           N+Y   E   D V +DYV  NG  PK   P TVL K
Sbjct: 646 NSYIRPEQMTDEV-WDYVFCNGPAPKTSIPSTVLTK 680


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 7,828,294
Number of Sequences: 37544
Number of extensions: 131448
Number of successful extensions: 231
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 230
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 231
length of database: 14,793,348
effective HSP length: 73
effective length of database: 12,052,636
effective search space used: 566473892
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)