BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301F01f (505 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive pep... 22 2.7 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 21 6.3 >EF222292-1|ABN79652.1| 354|Tribolium castaneum cardioactive peptide receptor 2 protein. Length = 354 Score = 22.2 bits (45), Expect = 2.7 Identities = 8/38 (21%), Positives = 23/38 (60%) Frame = -2 Query: 174 KLYLVMCFIEMFIFLSVSVASNYK*LMRVSFLAFSLLV 61 K+Y+ + + +F+F ++ +++ Y ++R + LL+ Sbjct: 204 KVYITLVALVLFVFPALIISACYAVIVRTIWSKSKLLI 241 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 21.0 bits (42), Expect = 6.3 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = -2 Query: 396 LYFCILMHYIN 364 LYFC +M Y+N Sbjct: 333 LYFCRIMVYLN 343 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 93,349 Number of Sequences: 336 Number of extensions: 1791 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11944578 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -