BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301E10f (360 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g10450.1 68417.m01717 60S ribosomal protein L9 (RPL90D) ribos... 135 1e-32 At1g33140.1 68414.m04093 60S ribosomal protein L9 (RPL90A/C) sim... 131 1e-31 At1g33120.1 68414.m04090 60S ribosomal protein L9 (RPL90B) simil... 131 1e-31 At1g05190.1 68414.m00523 ribosomal protein L6 family protein Sim... 40 7e-04 At1g79330.1 68414.m09245 latex-abundant protein, putative (AMC6)... 28 1.6 At4g28490.1 68417.m04076 leucine-rich repeat transmembrane prote... 27 3.8 At3g19320.1 68416.m02450 leucine-rich repeat family protein cont... 27 3.8 At1g42970.1 68414.m04947 glyceraldehyde-3-phosphate dehydrogenas... 27 3.8 At5g07320.1 68418.m00836 mitochondrial substrate carrier family ... 27 5.0 At1g03320.1 68414.m00311 hypothetical protein 26 6.6 At3g15605.1 68416.m01978 hypothetical protein 26 8.7 At3g04480.1 68416.m00475 endoribonuclease L-PSP family protein c... 26 8.7 At2g34030.1 68415.m04166 calcium-binding EF hand family protein ... 26 8.7 At1g79340.1 68414.m09246 latex-abundant protein, putative (AMC7)... 26 8.7 >At4g10450.1 68417.m01717 60S ribosomal protein L9 (RPL90D) ribosomal protein L9, cytosolic - garden pea, PIR2:S19978 Length = 194 Score = 135 bits (326), Expect = 1e-32 Identities = 61/123 (49%), Positives = 88/123 (71%), Gaps = 5/123 (4%) Frame = +3 Query: 6 IVANQKVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMVNP-----RLLKVEKW 170 I++++ + IPDG+ + V ++++ V+GPRG L R+FKHL +D +++ R LK++ W Sbjct: 4 ILSSETMDIPDGVAIKVNAKVIEVEGPRGKLTRDFKHLNLDFQLIKDQVTGKRQLKIDSW 63 Query: 171 FGSKKELAAVRTVCSHVENMIKGVTKGFQYKMRAVYAHFPINCVTTEGNSIIEIRNFLGE 350 FGS+K A++RT SHV+N+I GVT+GF Y+MR VYAHFPIN N IEIRNFLGE Sbjct: 64 FGSRKTSASIRTALSHVDNLIAGVTQGFLYRMRFVYAHFPINASIDGNNKSIEIRNFLGE 123 Query: 351 KYI 359 K + Sbjct: 124 KKV 126 >At1g33140.1 68414.m04093 60S ribosomal protein L9 (RPL90A/C) similar to RIBOSOMAL PROTEIN L9 GB:P49209 from [Arabidopsis thaliana] Length = 194 Score = 131 bits (317), Expect = 1e-31 Identities = 59/123 (47%), Positives = 88/123 (71%), Gaps = 5/123 (4%) Frame = +3 Query: 6 IVANQKVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMVNP-----RLLKVEKW 170 I++++ + IPD +T+ V ++++ V+GPRG L R+FKHL +D +++ + LK++ W Sbjct: 4 ILSSETMDIPDSVTIKVHAKVIEVEGPRGKLVRDFKHLNLDFQLIKDPETGKKKLKIDSW 63 Query: 171 FGSKKELAAVRTVCSHVENMIKGVTKGFQYKMRAVYAHFPINCVTTEGNSIIEIRNFLGE 350 FG++K A++RT SHV+N+I GVT+GF+YKMR VYAHFPIN IEIRNFLGE Sbjct: 64 FGTRKTSASIRTALSHVDNLISGVTRGFRYKMRFVYAHFPINASIGGDGKSIEIRNFLGE 123 Query: 351 KYI 359 K + Sbjct: 124 KKV 126 >At1g33120.1 68414.m04090 60S ribosomal protein L9 (RPL90B) similar to RIBOSOMAL PROTEIN L9 GB:P49209 from [Arabidopsis thaliana] Length = 194 Score = 131 bits (317), Expect = 1e-31 Identities = 59/123 (47%), Positives = 88/123 (71%), Gaps = 5/123 (4%) Frame = +3 Query: 6 IVANQKVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMVNP-----RLLKVEKW 170 I++++ + IPD +T+ V ++++ V+GPRG L R+FKHL +D +++ + LK++ W Sbjct: 4 ILSSETMDIPDSVTIKVHAKVIEVEGPRGKLVRDFKHLNLDFQLIKDPETGKKKLKIDSW 63 Query: 171 FGSKKELAAVRTVCSHVENMIKGVTKGFQYKMRAVYAHFPINCVTTEGNSIIEIRNFLGE 350 FG++K A++RT SHV+N+I GVT+GF+YKMR VYAHFPIN IEIRNFLGE Sbjct: 64 FGTRKTSASIRTALSHVDNLISGVTRGFRYKMRFVYAHFPINASIGGDGKSIEIRNFLGE 123 Query: 351 KYI 359 K + Sbjct: 124 KKV 126 >At1g05190.1 68414.m00523 ribosomal protein L6 family protein Similar to Mycobacterium RlpF (gb|Z84395). ESTs gb|T75785,gb|R30580,gb|T04698 come from this gene Length = 223 Score = 39.5 bits (88), Expect = 7e-04 Identities = 21/86 (24%), Positives = 44/86 (51%) Frame = +3 Query: 9 VANQKVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMVNPRLLKVEKWFGSKKE 188 + Q + +P +T+ ++ + + VKGP G L + V++ L+V+K +++ Sbjct: 46 IGKQPIAVPSNVTIALEGQDLKVKGPLGELALTYPR-EVELTKEESGFLRVKKTVETRRA 104 Query: 189 LAAVRTVCSHVENMIKGVTKGFQYKM 266 + +NM+ GV+KGF+ K+ Sbjct: 105 NQMHGLFRTLTDNMVVGVSKGFEKKL 130 >At1g79330.1 68414.m09245 latex-abundant protein, putative (AMC6) / caspase family protein similar to latex-abundant protein [Hevea brasiliensis] gb:AAD13216; contains Pfam domain, PF00656: ICE-like protease (caspase) p20 domain Length = 410 Score = 28.3 bits (60), Expect = 1.6 Identities = 12/48 (25%), Positives = 28/48 (58%) Frame = +3 Query: 18 QKVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMVNPRLLKV 161 +++K+ DG VHV ++ + ++ +LK+N + +++ + P L V Sbjct: 204 KELKLEDGAKVHVVNKSLPLQTLIDILKQNTGNNDIEVGKIRPTLFNV 251 >At4g28490.1 68417.m04076 leucine-rich repeat transmembrane protein kinase, putative Length = 999 Score = 27.1 bits (57), Expect = 3.8 Identities = 14/44 (31%), Positives = 25/44 (56%), Gaps = 2/44 (4%) Frame = -2 Query: 350 LPQEVTYLN--N*ITLSGDTVNGEVSIHSTHLVLEAFSYSFNHV 225 +P+EV L N + LS + +GE+ + +L L + S+NH+ Sbjct: 539 IPKEVGILPVLNYLDLSSNQFSGEIPLELQNLKLNVLNLSYNHL 582 >At3g19320.1 68416.m02450 leucine-rich repeat family protein contains leucine-rich repeats, Pfam:PF00560; Length = 493 Score = 27.1 bits (57), Expect = 3.8 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = -2 Query: 197 GGKLLFGSEPFLN-LQETRVYHANVNSQVFKVP 102 GGK L + FLN L+E ++HAN N+ V VP Sbjct: 187 GGKKL-RLDNFLNKLEEVTIFHANSNNFVGSVP 218 >At1g42970.1 68414.m04947 glyceraldehyde-3-phosphate dehydrogenase B, chloroplast (GAPB) / NADP-dependent glyceraldehydephosphate dehydrogenase subunit B identical to SP|P25857 Glyceraldehyde 3-phosphate dehydrogenase B, chloroplast precursor (EC 1.2.1.13) (NADP-dependent glyceraldehydephosphate dehydrogenase subunit B) {Arabidopsis thaliana} Length = 447 Score = 27.1 bits (57), Expect = 3.8 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +3 Query: 21 KVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDI 131 +VKI D T+ V +L+ V R LK + L +DI Sbjct: 138 EVKIVDNETISVDGKLIKVVSNRDPLKLPWAELGIDI 174 >At5g07320.1 68418.m00836 mitochondrial substrate carrier family protein similar to peroxisomal Ca-dependent solute carrier [Oryctolagus cuniculus] GI:2352427 (mitochondrial carrier superfamily); contains INTERPRO:IPR001993 Mitochondrial substrate carrier family, INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 479 Score = 26.6 bits (56), Expect = 5.0 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = +3 Query: 18 QKVKIPDGLTVHVK-SRLVTVKGPRGVLKR 104 ++ IPDG++ HVK SRL+ G G + R Sbjct: 191 EQAVIPDGISKHVKRSRLLLAGGLAGAVSR 220 >At1g03320.1 68414.m00311 hypothetical protein Length = 220 Score = 26.2 bits (55), Expect = 6.6 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = -2 Query: 104 PFENSAGPFNCHQTRFHMDRKPV 36 P+ +AGPF QTR +MD P+ Sbjct: 183 PYMAAAGPFPYWQTRPYMDANPM 205 >At3g15605.1 68416.m01978 hypothetical protein Length = 543 Score = 25.8 bits (54), Expect = 8.7 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -2 Query: 80 FNCHQTRFHMDRKPVWDFDFLIC 12 F HQ RF + +P WD FL C Sbjct: 109 FTRHQQRFLGEYEPQWDELFLAC 131 >At3g04480.1 68416.m00475 endoribonuclease L-PSP family protein contains Pfam domain PF01902: Domain of unknown function Length = 715 Score = 25.8 bits (54), Expect = 8.7 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = +3 Query: 111 KHLAVDIRMVNPRLLKVEKWFGS 179 KHL D+ + P LLK+++ +GS Sbjct: 173 KHLGKDLAFMEPYLLKLKEKYGS 195 >At2g34030.1 68415.m04166 calcium-binding EF hand family protein contains INTERPRO:IPR002048 calcium-binding EF-hand domain Length = 566 Score = 25.8 bits (54), Expect = 8.7 Identities = 15/49 (30%), Positives = 22/49 (44%) Frame = -3 Query: 232 IMFSTCEQTVLTAASSFLDPNHFSTFRRRGFTMRMSTAKCLKFLLRTPR 86 +M ST ASSF+D N T F++ + C+ F + PR Sbjct: 129 LMLSTGLSLSRDVASSFIDDNVGLTVGHTVFSLTIQWGACVVFSITGPR 177 >At1g79340.1 68414.m09246 latex-abundant protein, putative (AMC7) / caspase family protein similar to latex-abundant protein [Hevea brasiliensis] gb:AAD13216; contains Pfam domain, PF00656: ICE-like protease (caspase) p20 domain Length = 418 Score = 25.8 bits (54), Expect = 8.7 Identities = 9/48 (18%), Positives = 27/48 (56%) Frame = +3 Query: 9 VANQKVKIPDGLTVHVKSRLVTVKGPRGVLKRNFKHLAVDIRMVNPRL 152 + +++++ DG T+H K + + ++ +LK+ + +++ + P L Sbjct: 207 IETKEIELEDGETIHAKDKSLPLQTLIDILKQQTGNDNIEVGKIRPSL 254 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,256,286 Number of Sequences: 28952 Number of extensions: 159364 Number of successful extensions: 396 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 389 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 393 length of database: 12,070,560 effective HSP length: 72 effective length of database: 9,986,016 effective search space used: 469342752 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -