BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301E09f (428 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1400 - 37036957-37037705,37037809-37037995,37038108-370382... 29 2.1 03_03_0166 - 15027065-15028465 27 4.9 >01_06_1400 - 37036957-37037705,37037809-37037995,37038108-37038205, 37039562-37039655 Length = 375 Score = 28.7 bits (61), Expect = 2.1 Identities = 14/44 (31%), Positives = 23/44 (52%) Frame = +1 Query: 61 VILKILIQYPSFSIIDHINLLGIFIFVLR*FIFCVFFIFLHKNK 192 V + IL Q PSF + H+NL+ + + + F I+L +K Sbjct: 87 VFMMILAQMPSFHSLRHVNLISLVLCLAYSFCAVAACIYLGSSK 130 >03_03_0166 - 15027065-15028465 Length = 466 Score = 27.5 bits (58), Expect = 4.9 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -2 Query: 70 LELRHYNVLVLNLNGFFP 17 L R +VLV+N+NGFFP Sbjct: 127 LRARDVDVLVVNVNGFFP 144 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,206,546 Number of Sequences: 37544 Number of extensions: 177486 Number of successful extensions: 395 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 391 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 395 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 802495716 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -