BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301E09f (428 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF450317-1|AAL48256.1| 180|Homo sapiens MHC class II antigen pr... 32 0.72 BC104956-1|AAI04957.1| 1700|Homo sapiens SKIP protein protein. 31 1.7 BC104954-1|AAI04955.1| 1700|Homo sapiens SKIP protein protein. 31 1.7 AB051465-1|BAB21769.1| 1302|Homo sapiens KIAA1678 protein protein. 31 1.7 X12544-1|CAA31061.1| 296|Homo sapiens protein ( Human mRNA for ... 30 2.9 X02902-1|CAA26660.1| 266|Homo sapiens protein ( Human mRNA for ... 30 2.9 X00700-1|CAA25296.1| 266|Homo sapiens protein ( Human mRNA frag... 30 2.9 U84892-1|AAB42072.1| 266|Homo sapiens MHC class II antigen prot... 30 2.9 U70545-1|AAC51630.1| 81|Homo sapiens HLA class II antigen prot... 30 2.9 M57648-1|AAA63218.1| 266|Homo sapiens cell surface glycoprotein... 30 2.9 M35159-1|AAA59791.1| 266|Homo sapiens HLA-DRB1 protein. 30 2.9 M32578-1|AAA59795.1| 266|Homo sapiens HLA-DRB1 protein. 30 2.9 M20555-1|AAA59830.1| 232|Homo sapiens HLA-DRB4 protein. 30 2.9 M20503-1|AAA59826.1| 266|Homo sapiens HLA-DRB1 protein. 30 2.9 M20429-1|AAA59822.1| 266|Homo sapiens HLA-DRB1 protein. 30 2.9 M20138-1|AAA59832.1| 266|Homo sapiens HLA-DRB2 protein. 30 2.9 M16956-1|AAA36278.1| 237|Homo sapiens protein ( Human MHC class... 30 2.9 M16954-1|AAA36276.1| 237|Homo sapiens protein ( Human MHC class... 30 2.9 M16942-1|AAA36296.1| 266|Homo sapiens protein ( Human MHC class... 30 2.9 M16086-1|AAA59679.1| 193|Homo sapiens MHC class II DR-beta prot... 30 2.9 M15992-1|AAA59678.1| 237|Homo sapiens MHC class II DR-beta prot... 30 2.9 M15838-1|AAA52769.1| 220|Homo sapiens HLA-DRB4 protein. 30 2.9 M15375-1|AAA58652.1| 220|Homo sapiens MHC class II HLA-DR-beta-... 30 2.9 M15178-1|AAA35995.1| 246|Homo sapiens protein ( Human HLA-DR be... 30 2.9 M14661-1|AAA59799.1| 220|Homo sapiens HLA-DRB1 protein. 30 2.9 L42143-1|AAA67104.1| 266|Homo sapiens major histocompatibility ... 30 2.9 D89918-1|BAA14037.1| 72|Homo sapiens DRB4*0101102N protein. 30 2.9 D89879-1|BAA14036.1| 72|Homo sapiens HLA-DRB4*0102 protein. 30 2.9 DQ284435-1|ABC66201.1| 266|Homo sapiens MHC class II antigen pr... 30 2.9 DQ284433-1|ABC66200.1| 266|Homo sapiens MHC class II antigen pr... 30 2.9 DQ284432-1|ABC66199.1| 266|Homo sapiens MHC class II antigen pr... 30 2.9 DQ284431-1|ABC66198.1| 266|Homo sapiens MHC class II antigen pr... 30 2.9 BX571807-1|CAM25971.1| 266|Homo sapiens major histocompatibilit... 30 2.9 BX296568-4|CAM25996.1| 250|Homo sapiens major histocompatibilit... 30 2.9 BX296568-3|CAM25995.1| 266|Homo sapiens major histocompatibilit... 30 2.9 BX120007-3|CAM26205.1| 266|Homo sapiens major histocompatibilit... 30 2.9 BC024269-1|AAH24269.1| 266|Homo sapiens HLA-DRB1 protein protein. 30 2.9 BC009234-1|AAH09234.1| 266|Homo sapiens major histocompatibilit... 30 2.9 BC005312-1|AAH05312.1| 266|Homo sapiens major histocompatibilit... 30 2.9 AY961075-1|AAX63463.1| 266|Homo sapiens MHC class II antigen pr... 30 2.9 AY961074-1|AAX63462.1| 266|Homo sapiens MHC class II antigen pr... 30 2.9 AY961068-1|AAX63456.1| 266|Homo sapiens MHC class II antigen pr... 30 2.9 AY961063-1|AAX63451.1| 266|Homo sapiens MHC class II antigen pr... 30 2.9 AY961062-1|AAX63450.1| 266|Homo sapiens MHC class II antigen pr... 30 2.9 AY626552-1|AAV41230.1| 266|Homo sapiens MHC class II antigen pr... 30 2.9 AY195618-1|AAO43051.1| 183|Homo sapiens MHC class II antigen pr... 30 2.9 AY195616-1|AAO43050.1| 183|Homo sapiens MHC class II antigen pr... 30 2.9 AM109973-1|CAJ33580.1| 181|Homo sapiens MHC class II antigen pr... 30 2.9 AM109972-1|CAJ33579.1| 181|Homo sapiens MHC class II antigen pr... 30 2.9 AM109971-1|CAJ33578.1| 181|Homo sapiens MHC class II antigen pr... 30 2.9 AM109970-1|CAJ33577.1| 181|Homo sapiens MHC class II antigen pr... 30 2.9 AM109969-1|CAJ33576.1| 181|Homo sapiens MHC class II antigen pr... 30 2.9 AL713966-2|CAI18079.1| 266|Homo sapiens major histocompatibilit... 30 2.9 AL137064-2|CAC19360.1| 266|Homo sapiens dJ863G3.2 (major histoc... 30 2.9 AJ854064-1|CAH69440.3| 70|Homo sapiens MHC class II antigen pr... 30 2.9 AJ556173-1|CAD89003.1| 266|Homo sapiens MHC class II antigen pr... 30 2.9 AJ536121-1|CAD60087.1| 266|Homo sapiens MHC class II antigen pr... 30 2.9 AJ297586-1|CAC08826.2| 266|Homo sapiens MHC class II antigen pr... 30 2.9 AJ297582-1|CAC08822.1| 266|Homo sapiens MHC class II antigen pr... 30 2.9 AJ297503-1|CAC27124.1| 93|Homo sapiens human leucocyte antigen... 30 2.9 AJ245881-1|CAB75359.1| 264|Homo sapiens human leucocyte antigen... 30 2.9 AJ243701-1|CAB65103.1| 87|Homo sapiens human leucocyte antigen... 30 2.9 AF361549-1|AAM00253.1| 266|Homo sapiens MHC class II antigen pr... 30 2.9 AF361548-1|AAM00252.1| 266|Homo sapiens MHC class II antigen pr... 30 2.9 AF291675-1|AAK91825.1| 266|Homo sapiens MHC class II antigen pr... 30 2.9 AF048707-1|AAC31951.1| 219|Homo sapiens MHC class II antigen pr... 30 2.9 AK021601-1|BAB13853.1| 143|Homo sapiens protein ( Homo sapiens ... 30 3.8 AB075501-1|BAE45751.1| 143|Homo sapiens putative protein produc... 30 3.8 BX571740-1|CAE11866.1| 603|Homo sapiens hypothetical protein pr... 29 6.7 BC039089-1|AAH39089.1| 612|Homo sapiens RPGRIP1 protein protein. 29 6.7 AJ417067-1|CAD01135.1| 1286|Homo sapiens RPGR-interacting protei... 29 6.7 AJ417048-1|CAD01136.1| 1286|Homo sapiens RPGR-interacting protei... 29 6.7 AF265667-1|AAG10001.1| 645|Homo sapiens RPGR-interacting protei... 29 6.7 AF265666-1|AAG10000.1| 669|Homo sapiens RPGR-interacting protei... 29 6.7 AF260257-1|AAF91371.1| 902|Homo sapiens RPGR-interacting protei... 29 6.7 AF227257-1|AAG10246.1| 762|Homo sapiens RPGR-interacting protei... 29 6.7 >AF450317-1|AAL48256.1| 180|Homo sapiens MHC class II antigen protein. Length = 180 Score = 32.3 bits (70), Expect = 0.72 Identities = 11/17 (64%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+HYN+LV ++NGF+PG Sbjct: 104 LQHYNLLVCSVNGFYPG 120 >BC104956-1|AAI04957.1| 1700|Homo sapiens SKIP protein protein. Length = 1700 Score = 31.1 bits (67), Expect = 1.7 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 5/49 (10%) Frame = -2 Query: 421 HPFQSKDSKECKTIQVVELTSQ-----DDILIPPTQFTDTKDPKVYCIT 290 HP +++ C T ++ E+ DD+L+P TK P +YCIT Sbjct: 880 HP-NTQEKYNCATSRINEVQVNLSLLGDDLLLPAQSTLQTKHPDIYCIT 927 >BC104954-1|AAI04955.1| 1700|Homo sapiens SKIP protein protein. Length = 1700 Score = 31.1 bits (67), Expect = 1.7 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 5/49 (10%) Frame = -2 Query: 421 HPFQSKDSKECKTIQVVELTSQ-----DDILIPPTQFTDTKDPKVYCIT 290 HP +++ C T ++ E+ DD+L+P TK P +YCIT Sbjct: 880 HP-NTQEKYNCATSRINEVQVNLSLLGDDLLLPAQSTLQTKHPDIYCIT 927 >AB051465-1|BAB21769.1| 1302|Homo sapiens KIAA1678 protein protein. Length = 1302 Score = 31.1 bits (67), Expect = 1.7 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 5/49 (10%) Frame = -2 Query: 421 HPFQSKDSKECKTIQVVELTSQ-----DDILIPPTQFTDTKDPKVYCIT 290 HP +++ C T ++ E+ DD+L+P TK P +YCIT Sbjct: 511 HP-NTQEKYNCATSRINEVQVNLSLLGDDLLLPAQSTLQTKHPDIYCIT 558 >X12544-1|CAA31061.1| 296|Homo sapiens protein ( Human mRNA for HLA class II DR-beta (HLA-DR B). ). Length = 296 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 138 LQHHNLLVCSVNGFYPG 154 >X02902-1|CAA26660.1| 266|Homo sapiens protein ( Human mRNA for HLA class II DR-beta 1 (Dw14). ). Length = 266 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 138 LQHHNLLVCSVNGFYPG 154 >X00700-1|CAA25296.1| 266|Homo sapiens protein ( Human mRNA fragment for class II histocompatibility antigen beta-chain (pII-beta-4). ). Length = 266 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 138 LQHHNLLVCSVNGFYPG 154 >U84892-1|AAB42072.1| 266|Homo sapiens MHC class II antigen protein. Length = 266 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 138 LQHHNLLVCSVNGFYPG 154 >U70545-1|AAC51630.1| 81|Homo sapiens HLA class II antigen protein. Length = 81 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 14 LQHHNLLVCSVNGFYPG 30 >M57648-1|AAA63218.1| 266|Homo sapiens cell surface glycoprotein protein. Length = 266 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 138 LQHHNLLVCSVNGFYPG 154 >M35159-1|AAA59791.1| 266|Homo sapiens HLA-DRB1 protein. Length = 266 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 138 LQHHNLLVCSVNGFYPG 154 >M32578-1|AAA59795.1| 266|Homo sapiens HLA-DRB1 protein. Length = 266 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 138 LQHHNLLVCSVNGFYPG 154 >M20555-1|AAA59830.1| 232|Homo sapiens HLA-DRB4 protein. Length = 232 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 104 LQHHNLLVCSVNGFYPG 120 >M20503-1|AAA59826.1| 266|Homo sapiens HLA-DRB1 protein. Length = 266 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 138 LQHHNLLVCSVNGFYPG 154 >M20429-1|AAA59822.1| 266|Homo sapiens HLA-DRB1 protein. Length = 266 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 138 LQHHNLLVCSVNGFYPG 154 >M20138-1|AAA59832.1| 266|Homo sapiens HLA-DRB2 protein. Length = 266 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 138 LQHHNLLVCSVNGFYPG 154 >M16956-1|AAA36278.1| 237|Homo sapiens protein ( Human MHC class II HLA-DR2 (non-Dw2/non-Dw12) a-associated glycoprotein beta-chain mRNA, 3' end. ). Length = 237 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 109 LQHHNLLVCSVNGFYPG 125 >M16954-1|AAA36276.1| 237|Homo sapiens protein ( Human MHC class II HLA-DR2 (Dw2) a-associated glycoprotein beta-chain mRNA, 3' end. ). Length = 237 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 109 LQHHNLLVCSVNGFYPG 125 >M16942-1|AAA36296.1| 266|Homo sapiens protein ( Human MHC class II HLA-DRw53-associated glycoprotein beta- chain mRNA, complete cds. ). Length = 266 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 138 LQHHNLLVCSVNGFYPG 154 >M16086-1|AAA59679.1| 193|Homo sapiens MHC class II DR-beta protein. Length = 193 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 65 LQHHNLLVCSVNGFYPG 81 >M15992-1|AAA59678.1| 237|Homo sapiens MHC class II DR-beta protein. Length = 237 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 109 LQHHNLLVCSVNGFYPG 125 >M15838-1|AAA52769.1| 220|Homo sapiens HLA-DRB4 protein. Length = 220 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 104 LQHHNLLVCSVNGFYPG 120 >M15375-1|AAA58652.1| 220|Homo sapiens MHC class II HLA-DR-beta-4 protein. Length = 220 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 104 LQHHNLLVCSVNGFYPG 120 >M15178-1|AAA35995.1| 246|Homo sapiens protein ( Human HLA-DR beta-chain mRNA, partial cds. ). Length = 246 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 118 LQHHNLLVCSVNGFYPG 134 >M14661-1|AAA59799.1| 220|Homo sapiens HLA-DRB1 protein. Length = 220 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 92 LQHHNLLVCSVNGFYPG 108 >L42143-1|AAA67104.1| 266|Homo sapiens major histocompatibility complex protein. Length = 266 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 138 LQHHNLLVCSVNGFYPG 154 >D89918-1|BAA14037.1| 72|Homo sapiens DRB4*0101102N protein. Length = 72 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 5 LQHHNLLVCSVNGFYPG 21 >D89879-1|BAA14036.1| 72|Homo sapiens HLA-DRB4*0102 protein. Length = 72 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 5 LQHHNLLVCSVNGFYPG 21 >DQ284435-1|ABC66201.1| 266|Homo sapiens MHC class II antigen protein. Length = 266 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 138 LQHHNLLVCSVNGFYPG 154 >DQ284433-1|ABC66200.1| 266|Homo sapiens MHC class II antigen protein. Length = 266 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 138 LQHHNLLVCSVNGFYPG 154 >DQ284432-1|ABC66199.1| 266|Homo sapiens MHC class II antigen protein. Length = 266 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 138 LQHHNLLVCSVNGFYPG 154 >DQ284431-1|ABC66198.1| 266|Homo sapiens MHC class II antigen protein. Length = 266 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 138 LQHHNLLVCSVNGFYPG 154 >BX571807-1|CAM25971.1| 266|Homo sapiens major histocompatibility complex class II DR betang protein) (BECN1) pseudogene protein. Length = 266 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 138 LQHHNLLVCSVNGFYPG 154 >BX296568-4|CAM25996.1| 250|Homo sapiens major histocompatibility complex, class II, DR beta 1 protein. Length = 250 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 171 LQHHNLLVCSVNGFYPG 187 >BX296568-3|CAM25995.1| 266|Homo sapiens major histocompatibility complex, class II, DR beta 1 protein. Length = 266 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 138 LQHHNLLVCSVNGFYPG 154 >BX120007-3|CAM26205.1| 266|Homo sapiens major histocompatibility complex class II DR beta1 protein. Length = 266 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 138 LQHHNLLVCSVNGFYPG 154 >BC024269-1|AAH24269.1| 266|Homo sapiens HLA-DRB1 protein protein. Length = 266 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 138 LQHHNLLVCSVNGFYPG 154 >BC009234-1|AAH09234.1| 266|Homo sapiens major histocompatibility complex, class II, DR beta 5 protein. Length = 266 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 138 LQHHNLLVCSVNGFYPG 154 >BC005312-1|AAH05312.1| 266|Homo sapiens major histocompatibility complex, class II, DR beta 4 protein. Length = 266 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 138 LQHHNLLVCSVNGFYPG 154 >AY961075-1|AAX63463.1| 266|Homo sapiens MHC class II antigen protein. Length = 266 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 138 LQHHNLLVCSVNGFYPG 154 >AY961074-1|AAX63462.1| 266|Homo sapiens MHC class II antigen protein. Length = 266 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 138 LQHHNLLVCSVNGFYPG 154 >AY961068-1|AAX63456.1| 266|Homo sapiens MHC class II antigen protein. Length = 266 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 138 LQHHNLLVCSVNGFYPG 154 >AY961063-1|AAX63451.1| 266|Homo sapiens MHC class II antigen protein. Length = 266 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 138 LQHHNLLVCSVNGFYPG 154 >AY961062-1|AAX63450.1| 266|Homo sapiens MHC class II antigen protein. Length = 266 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 138 LQHHNLLVCSVNGFYPG 154 >AY626552-1|AAV41230.1| 266|Homo sapiens MHC class II antigen protein. Length = 266 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 138 LQHHNLLVCSVNGFYPG 154 >AY195618-1|AAO43051.1| 183|Homo sapiens MHC class II antigen protein. Length = 183 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 104 LQHHNLLVCSVNGFYPG 120 >AY195616-1|AAO43050.1| 183|Homo sapiens MHC class II antigen protein. Length = 183 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 104 LQHHNLLVCSVNGFYPG 120 >AM109973-1|CAJ33580.1| 181|Homo sapiens MHC class II antigen protein. Length = 181 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 104 LQHHNLLVCSVNGFYPG 120 >AM109972-1|CAJ33579.1| 181|Homo sapiens MHC class II antigen protein. Length = 181 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 104 LQHHNLLVCSVNGFYPG 120 >AM109971-1|CAJ33578.1| 181|Homo sapiens MHC class II antigen protein. Length = 181 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 104 LQHHNLLVCSVNGFYPG 120 >AM109970-1|CAJ33577.1| 181|Homo sapiens MHC class II antigen protein. Length = 181 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 104 LQHHNLLVCSVNGFYPG 120 >AM109969-1|CAJ33576.1| 181|Homo sapiens MHC class II antigen protein. Length = 181 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 104 LQHHNLLVCSVNGFYPG 120 >AL713966-2|CAI18079.1| 266|Homo sapiens major histocompatibility complex, class II, DR beta 5 protein. Length = 266 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 138 LQHHNLLVCSVNGFYPG 154 >AL137064-2|CAC19360.1| 266|Homo sapiens dJ863G3.2 (major histocompatibility complex, class II, DR beta 1) protein. Length = 266 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 138 LQHHNLLVCSVNGFYPG 154 >AJ854064-1|CAH69440.3| 70|Homo sapiens MHC class II antigen protein. Length = 70 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 1 LQHHNLLVCSVNGFYPG 17 >AJ556173-1|CAD89003.1| 266|Homo sapiens MHC class II antigen protein. Length = 266 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 138 LQHHNLLVCSVNGFYPG 154 >AJ536121-1|CAD60087.1| 266|Homo sapiens MHC class II antigen protein. Length = 266 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 138 LQHHNLLVCSVNGFYPG 154 >AJ297586-1|CAC08826.2| 266|Homo sapiens MHC class II antigen protein. Length = 266 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 138 LQHHNLLVCSVNGFYPG 154 >AJ297582-1|CAC08822.1| 266|Homo sapiens MHC class II antigen protein. Length = 266 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+HYN+LV +++GF+PG Sbjct: 138 LQHYNLLVCSVSGFYPG 154 >AJ297503-1|CAC27124.1| 93|Homo sapiens human leucocyte antigen DRB4 protein. Length = 93 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 14 LQHHNLLVCSVNGFYPG 30 >AJ245881-1|CAB75359.1| 264|Homo sapiens human leucocyte antigen DRB1 protein. Length = 264 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 136 LQHHNLLVCSVNGFYPG 152 >AJ243701-1|CAB65103.1| 87|Homo sapiens human leucocyte antigen DRB4 protein. Length = 87 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 8 LQHHNLLVCSVNGFYPG 24 >AF361549-1|AAM00253.1| 266|Homo sapiens MHC class II antigen protein. Length = 266 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 138 LQHHNLLVCSVNGFYPG 154 >AF361548-1|AAM00252.1| 266|Homo sapiens MHC class II antigen protein. Length = 266 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 138 LQHHNLLVCSVNGFYPG 154 >AF291675-1|AAK91825.1| 266|Homo sapiens MHC class II antigen protein. Length = 266 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 138 LQHHNLLVCSVNGFYPG 154 >AF048707-1|AAC31951.1| 219|Homo sapiens MHC class II antigen protein. Length = 219 Score = 30.3 bits (65), Expect = 2.9 Identities = 10/17 (58%), Positives = 16/17 (94%) Frame = -2 Query: 64 LRHYNVLVLNLNGFFPG 14 L+H+N+LV ++NGF+PG Sbjct: 91 LQHHNLLVCSVNGFYPG 107 >AK021601-1|BAB13853.1| 143|Homo sapiens protein ( Homo sapiens cDNA FLJ11539 fis, clone HEMBA1002748. ). Length = 143 Score = 29.9 bits (64), Expect = 3.8 Identities = 17/35 (48%), Positives = 22/35 (62%) Frame = +2 Query: 89 PASASSTTSICLAFSFSCCDSLFFVFFSSSCIKTK 193 PA A T S C+ FS C L+F+ F SSC+KT+ Sbjct: 21 PARAGRTVSSCI---FSSC--LWFLPFRSSCLKTQ 50 >AB075501-1|BAE45751.1| 143|Homo sapiens putative protein product of Nbla00301 protein. Length = 143 Score = 29.9 bits (64), Expect = 3.8 Identities = 17/35 (48%), Positives = 22/35 (62%) Frame = +2 Query: 89 PASASSTTSICLAFSFSCCDSLFFVFFSSSCIKTK 193 PA A T S C+ FS C L+F+ F SSC+KT+ Sbjct: 21 PARAGRTVSSCI---FSSC--LWFLPFRSSCLKTQ 50 >BX571740-1|CAE11866.1| 603|Homo sapiens hypothetical protein protein. Length = 603 Score = 29.1 bits (62), Expect = 6.7 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = -2 Query: 421 HPFQSKDSKECKT-IQVVELTSQDDILIPP-TQFTDTKDPKVYCITYIYL 278 HP K+S E + + + T DD+++PP +Q D + CI + L Sbjct: 393 HPVNDKESSEQGSEVSEAQTTDSDDVIVPPMSQKYPKADSEKMCIEIVSL 442 >BC039089-1|AAH39089.1| 612|Homo sapiens RPGRIP1 protein protein. Length = 612 Score = 29.1 bits (62), Expect = 6.7 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = -2 Query: 421 HPFQSKDSKECKT-IQVVELTSQDDILIPP-TQFTDTKDPKVYCITYIYL 278 HP K+S E + + + T DD+++PP +Q D + CI + L Sbjct: 402 HPVNDKESSEQGSEVSEAQTTDSDDVIVPPMSQKYPKADSEKMCIEIVSL 451 >AJ417067-1|CAD01135.1| 1286|Homo sapiens RPGR-interacting protein 1 protein. Length = 1286 Score = 29.1 bits (62), Expect = 6.7 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = -2 Query: 421 HPFQSKDSKECKT-IQVVELTSQDDILIPP-TQFTDTKDPKVYCITYIYL 278 HP K+S E + + + T DD+++PP +Q D + CI + L Sbjct: 1076 HPVNDKESSEQGSEVSEAQTTDSDDVIVPPMSQKYPKADSEKMCIEIVSL 1125 >AJ417048-1|CAD01136.1| 1286|Homo sapiens RPGR-interacting protein 1 protein. Length = 1286 Score = 29.1 bits (62), Expect = 6.7 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = -2 Query: 421 HPFQSKDSKECKT-IQVVELTSQDDILIPP-TQFTDTKDPKVYCITYIYL 278 HP K+S E + + + T DD+++PP +Q D + CI + L Sbjct: 1076 HPVNDKESSEQGSEVSEAQTTDSDDVIVPPMSQKYPKADSEKMCIEIVSL 1125 >AF265667-1|AAG10001.1| 645|Homo sapiens RPGR-interacting protein 1 isoform b protein. Length = 645 Score = 29.1 bits (62), Expect = 6.7 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = -2 Query: 421 HPFQSKDSKECKT-IQVVELTSQDDILIPP-TQFTDTKDPKVYCITYIYL 278 HP K+S E + + + T DD+++PP +Q D + CI + L Sbjct: 435 HPVNDKESSEQGSEVSEAQTTDSDDVIVPPMSQKYPKADSEKMCIEIVSL 484 >AF265666-1|AAG10000.1| 669|Homo sapiens RPGR-interacting protein 1 isoform a protein. Length = 669 Score = 29.1 bits (62), Expect = 6.7 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = -2 Query: 421 HPFQSKDSKECKT-IQVVELTSQDDILIPP-TQFTDTKDPKVYCITYIYL 278 HP K+S E + + + T DD+++PP +Q D + CI + L Sbjct: 459 HPVNDKESSEQGSEVSEAQTTDSDDVIVPPMSQKYPKADSEKMCIEIVSL 508 >AF260257-1|AAF91371.1| 902|Homo sapiens RPGR-interacting protein protein. Length = 902 Score = 29.1 bits (62), Expect = 6.7 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = -2 Query: 421 HPFQSKDSKECKT-IQVVELTSQDDILIPP-TQFTDTKDPKVYCITYIYL 278 HP K+S E + + + T DD+++PP +Q D + CI + L Sbjct: 692 HPVNDKESSEQGSEVSEAQTTDSDDVIVPPMSQKYPKADSEKMCIEIVSL 741 >AF227257-1|AAG10246.1| 762|Homo sapiens RPGR-interacting protein-1 protein. Length = 762 Score = 29.1 bits (62), Expect = 6.7 Identities = 15/50 (30%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = -2 Query: 421 HPFQSKDSKECKT-IQVVELTSQDDILIPP-TQFTDTKDPKVYCITYIYL 278 HP K+S E + + + T DD+++PP +Q D + CI + L Sbjct: 552 HPVNDKESSEQGSEVSEAQTTDSDDVIVPPMSQKYPKADSEKMCIEIVSL 601 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 58,500,657 Number of Sequences: 237096 Number of extensions: 1077842 Number of successful extensions: 2315 Number of sequences better than 10.0: 76 Number of HSP's better than 10.0 without gapping: 2270 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2313 length of database: 76,859,062 effective HSP length: 83 effective length of database: 57,180,094 effective search space used: 3373625546 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -