BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301E07f (447 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24924| Best HMM Match : WHEP-TRS (HMM E-Value=1.1) 28 3.1 SB_15453| Best HMM Match : Prenyltrans (HMM E-Value=0) 28 4.0 SB_16622| Best HMM Match : zf-C2H2 (HMM E-Value=0) 27 5.3 SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.3 SB_7343| Best HMM Match : EGF (HMM E-Value=0) 27 9.3 >SB_24924| Best HMM Match : WHEP-TRS (HMM E-Value=1.1) Length = 1002 Score = 28.3 bits (60), Expect = 3.1 Identities = 17/54 (31%), Positives = 20/54 (37%) Frame = -1 Query: 273 HVSLYHLRNWRINSPGARSSRGANYGLISRCLCHFCGSRRFCCFGSLCRRLSGI 112 H++L+ RI S A RCLC CG C G RL I Sbjct: 671 HITLHANTRRRICSRSGHKGTSACSSFYYRCLCEDCGKPYSTCDGLPSSRLHDI 724 >SB_15453| Best HMM Match : Prenyltrans (HMM E-Value=0) Length = 2376 Score = 27.9 bits (59), Expect = 4.0 Identities = 18/59 (30%), Positives = 24/59 (40%), Gaps = 2/59 (3%) Frame = +2 Query: 275 QTDSAFAQPTPHALLPKTIQKCTRTF--TDALALIPTRSKFLYADNLLHRYRIACSXIQ 445 Q A P PH L IQ TF TDA+ +P+ + +RY C+ Q Sbjct: 1888 QYSRPLAVPMPHYLYQAPIQPVFTTFGGTDAILFVPSADPTSIHNLWRYRYHTICTKRQ 1946 >SB_16622| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 1239 Score = 27.5 bits (58), Expect = 5.3 Identities = 22/73 (30%), Positives = 28/73 (38%), Gaps = 2/73 (2%) Frame = -1 Query: 357 SVNVRVHFCIVFGNSACGVG*ANAESVCHVSLYH--LRNWRINSPGARSSRGANYGLISR 184 +V+VR H VF CG ++ S+ L H R +R P S G L Sbjct: 1129 AVHVRTHSDKVFQCDQCGKSFRHSRSLARHELLHSGQRPYRCTEPECEQSFGRQDHLTDH 1188 Query: 183 CLCHFCGSRRFCC 145 H G R F C Sbjct: 1189 LRTH-TGERPFQC 1200 >SB_30234| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 5222 Score = 27.1 bits (57), Expect = 7.1 Identities = 12/36 (33%), Positives = 19/36 (52%) Frame = -1 Query: 249 NWRINSPGARSSRGANYGLISRCLCHFCGSRRFCCF 142 NW+ P + + G + GL + C CGS +FC + Sbjct: 452 NWK---PCLKGTYGDSAGLANITSCRPCGSGKFCAY 484 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 26.6 bits (56), Expect = 9.3 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -3 Query: 118 RYLLLGACPWEHWQPRKHKPP 56 +Y L G C + PRKHK P Sbjct: 340 KYRLPGGCGYNDHDPRKHKKP 360 >SB_7343| Best HMM Match : EGF (HMM E-Value=0) Length = 1233 Score = 26.6 bits (56), Expect = 9.3 Identities = 14/38 (36%), Positives = 17/38 (44%), Gaps = 7/38 (18%) Frame = -1 Query: 171 FCGSRRF-------CCFGSLCRRLSGICYLEPVLGNIG 79 +CGSR C FGS CR G+ + LG G Sbjct: 1000 YCGSRSIPCLDYNPCAFGSTCREKQGVVTCDCPLGRTG 1037 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,328,983 Number of Sequences: 59808 Number of extensions: 221626 Number of successful extensions: 712 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 673 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 712 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 883875528 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -