BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301E05f (396 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_32060| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.5 SB_12796| Best HMM Match : Radical_SAM (HMM E-Value=8.9e-24) 26 9.6 >SB_32060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1162 Score = 27.1 bits (57), Expect = 5.5 Identities = 12/21 (57%), Positives = 16/21 (76%) Frame = -1 Query: 279 IFILCIVSADFIAVLCLIDFR 217 IF + + A FIA++CLIDFR Sbjct: 13 IFAVVALFALFIALVCLIDFR 33 >SB_12796| Best HMM Match : Radical_SAM (HMM E-Value=8.9e-24) Length = 676 Score = 26.2 bits (55), Expect = 9.6 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = +2 Query: 188 VDKIVDTSIERKSIRQSTAMKSAETIQRIKIRS 286 +D IV TS++R + A AET+++IK R+ Sbjct: 115 LDYIVITSVDRDDLPDGGAGHFAETVRQIKKRN 147 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,585,083 Number of Sequences: 59808 Number of extensions: 65565 Number of successful extensions: 193 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 183 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 193 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 690807992 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -