BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301E05f (396 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81486-6|CAB03988.2| 309|Caenorhabditis elegans Hypothetical pr... 28 2.1 AF016448-14|AAB65960.2| 304|Caenorhabditis elegans Hypothetical... 28 2.1 Z70756-1|CAA94789.1| 1295|Caenorhabditis elegans Hypothetical pr... 27 6.4 AC006633-6|AAK68378.4| 578|Caenorhabditis elegans Hypothetical ... 27 6.4 >Z81486-6|CAB03988.2| 309|Caenorhabditis elegans Hypothetical protein C53A5.8 protein. Length = 309 Score = 28.3 bits (60), Expect = 2.1 Identities = 13/29 (44%), Positives = 19/29 (65%), Gaps = 3/29 (10%) Frame = -2 Query: 233 VLLISVLL---RYQQFCPQHFCFVFQLCL 156 +LL S+L+ RY QFCP F ++F + L Sbjct: 242 ILLWSILMALNRYFQFCPPSFGYIFNMSL 270 >AF016448-14|AAB65960.2| 304|Caenorhabditis elegans Hypothetical protein F41E6.12 protein. Length = 304 Score = 28.3 bits (60), Expect = 2.1 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +2 Query: 161 KVEKQNKSAVDKIVDTSIERKSIRQSTAMKSAETIQRIKI 280 K+ K +S+ DK+VD IE S+ T+ +KI Sbjct: 117 KLPKPERSSTDKVVDQVIEHSGPASSSEETKNSTVPEVKI 156 >Z70756-1|CAA94789.1| 1295|Caenorhabditis elegans Hypothetical protein T06E4.1 protein. Length = 1295 Score = 26.6 bits (56), Expect = 6.4 Identities = 11/40 (27%), Positives = 24/40 (60%) Frame = +2 Query: 158 DKVEKQNKSAVDKIVDTSIERKSIRQSTAMKSAETIQRIK 277 + + ++ K++VDK+ +E + I+ T+++ E RIK Sbjct: 556 ETMRREYKASVDKVCSLQLELEEIQHETSVELEEAEIRIK 595 >AC006633-6|AAK68378.4| 578|Caenorhabditis elegans Hypothetical protein F35B3.7 protein. Length = 578 Score = 26.6 bits (56), Expect = 6.4 Identities = 12/28 (42%), Positives = 19/28 (67%) Frame = +2 Query: 170 KQNKSAVDKIVDTSIERKSIRQSTAMKS 253 K++K+A + + +T IERKSI + KS Sbjct: 86 KRDKNATECLAETKIERKSICREKTHKS 113 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,262,042 Number of Sequences: 27780 Number of extensions: 53352 Number of successful extensions: 244 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 239 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 242 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 609015246 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -