BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301D11f (502 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK126796-1|BAC86698.1| 195|Homo sapiens protein ( Homo sapiens ... 31 2.3 AB018311-1|BAA34488.1| 872|Homo sapiens KIAA0768 protein protein. 31 3.0 >AK126796-1|BAC86698.1| 195|Homo sapiens protein ( Homo sapiens cDNA FLJ44846 fis, clone BRACE3051144. ). Length = 195 Score = 31.1 bits (67), Expect = 2.3 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 86 CATVCLWTSLCDCCC 42 C +CLW SLC+C C Sbjct: 49 CGCLCLWVSLCECPC 63 >AB018311-1|BAA34488.1| 872|Homo sapiens KIAA0768 protein protein. Length = 872 Score = 30.7 bits (66), Expect = 3.0 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +3 Query: 66 PQTHSRTFFLINTNYYVIHFKLPHRITFYIS 158 PQ HS +FF + TN + + PHR + Y S Sbjct: 754 PQDHSESFFPLLTNEHTEDLQSPHRDSLYTS 784 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 57,639,693 Number of Sequences: 237096 Number of extensions: 1008985 Number of successful extensions: 1242 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1133 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1237 length of database: 76,859,062 effective HSP length: 85 effective length of database: 56,705,902 effective search space used: 4593178062 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -