BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301D10f (484 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12207| Best HMM Match : Cytochrom_B_N (HMM E-Value=2.3e-07) 78 4e-15 SB_27597| Best HMM Match : Cytochrom_B_N (HMM E-Value=0) 38 0.003 SB_34117| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.1 >SB_12207| Best HMM Match : Cytochrom_B_N (HMM E-Value=2.3e-07) Length = 102 Score = 77.8 bits (183), Expect = 4e-15 Identities = 31/56 (55%), Positives = 45/56 (80%) Frame = +1 Query: 133 IYYTANIEIAFYRVNYICRNVNYG*IIRTLHANGASFFFICIYLHIGRGIYYESFN 300 ++Y A++ +AF V++I R+VNYG ++R HANGAS FFIC+Y HIGRG+YY S++ Sbjct: 1 MHYCADVSLAFASVDHIMRDVNYGFLLRYAHANGASMFFICLYAHIGRGLYYGSYS 56 >SB_27597| Best HMM Match : Cytochrom_B_N (HMM E-Value=0) Length = 135 Score = 38.3 bits (85), Expect = 0.003 Identities = 24/90 (26%), Positives = 39/90 (43%), Gaps = 2/90 (2%) Frame = +1 Query: 193 VNYG*IIRTLHANGASFFFICIYLHIGRGIYYESFNL--KYV*LXXXXXXXXXXXXXXXX 366 VN+G +IR++H AS + + LH+ R F + + Sbjct: 4 VNFGWLIRSVHRWSASMMVLMMILHVFRVYLTGGFKKPRELTWVTGVVLAVLTASFGVTG 63 Query: 367 YVLP*GQISFWGATVITNLLSAIPYLGTIL 456 Y LP QI +W ++T + AIP +G+ L Sbjct: 64 YSLPRDQIGYWAVKIVTGVPEAIPVIGSPL 93 >SB_34117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.5 bits (58), Expect = 6.1 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +3 Query: 300 LKICMINWNYNFIYTNSNCFHRLCLTLRSNIFLG 401 LKI M+N+ Y FI+ C L LRSN+ G Sbjct: 110 LKILMVNYRYKFIFIVKECKVMTDL-LRSNVDSG 142 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,115,540 Number of Sequences: 59808 Number of extensions: 189146 Number of successful extensions: 291 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 282 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 290 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1013948003 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -