BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301D09f (399 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. 24 1.8 AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. 24 1.8 AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. 24 1.8 >U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. Length = 692 Score = 24.2 bits (50), Expect = 1.8 Identities = 19/81 (23%), Positives = 37/81 (45%), Gaps = 9/81 (11%) Frame = -3 Query: 307 VWKLSVAYFSNNSIRIRTC*YPVVFITKRG---------TFENYLSYFYLRLYSN*TCIY 155 ++++ YF N + IRT Y ++ K G + NY + + + Y+N Sbjct: 162 IYEIYPYYFFNTDV-IRTINYKKLYDPKFGFYGNGKYNIVYANYTATYPMDYYNNFYTEE 220 Query: 154 YLHFNYFDLSDQSTYIRIIID 92 YL++N D+ + Y ++D Sbjct: 221 YLNYNTEDIGLNAYYYYFMMD 241 >AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 24.2 bits (50), Expect = 1.8 Identities = 19/81 (23%), Positives = 37/81 (45%), Gaps = 9/81 (11%) Frame = -3 Query: 307 VWKLSVAYFSNNSIRIRTC*YPVVFITKRG---------TFENYLSYFYLRLYSN*TCIY 155 ++++ YF N + IRT Y ++ K G + NY + + + Y+N Sbjct: 162 IYEIYPYYFFNTDV-IRTINYKKLYNPKFGFYGNGKYNVVYANYTATYPMDYYNNFYTEE 220 Query: 154 YLHFNYFDLSDQSTYIRIIID 92 YL++N D+ + Y ++D Sbjct: 221 YLNYNTEDIGLNAYYYYFMMD 241 >AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 24.2 bits (50), Expect = 1.8 Identities = 19/81 (23%), Positives = 37/81 (45%), Gaps = 9/81 (11%) Frame = -3 Query: 307 VWKLSVAYFSNNSIRIRTC*YPVVFITKRG---------TFENYLSYFYLRLYSN*TCIY 155 ++++ YF N + IRT Y ++ K G + NY + + + Y+N Sbjct: 162 IYEIYPYYFFNTDV-IRTINYKKLYNPKFGFYGNGKYNVVYANYTATYPMDYYNNFYTEE 220 Query: 154 YLHFNYFDLSDQSTYIRIIID 92 YL++N D+ + Y ++D Sbjct: 221 YLNYNTEDIGLNAYYYYFMMD 241 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 352,620 Number of Sequences: 2352 Number of extensions: 5878 Number of successful extensions: 5 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 31639662 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -