BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301D09f (399 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF106579-8|AAC78201.1| 710|Caenorhabditis elegans Hypothetical ... 27 6.5 AF101316-4|AAC69229.2| 296|Caenorhabditis elegans Serpentine re... 26 8.7 >AF106579-8|AAC78201.1| 710|Caenorhabditis elegans Hypothetical protein F54E2.5 protein. Length = 710 Score = 26.6 bits (56), Expect = 6.5 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = -3 Query: 283 FSNNSIRIRTC*YPVVFITKRGTFENYLSYFYLRLYS 173 FSN I I C +P VF+ F N+ S Y+ L S Sbjct: 496 FSNLVIAIHPCQFPAVFLV-LNIFLNFSSIIYIWLMS 531 >AF101316-4|AAC69229.2| 296|Caenorhabditis elegans Serpentine receptor, class sx protein8 protein. Length = 296 Score = 26.2 bits (55), Expect = 8.7 Identities = 10/28 (35%), Positives = 19/28 (67%) Frame = -2 Query: 365 LIIRVS*VTTFRSKHDAFQCLETFSRIF 282 LI + ++FRSK QC+++F+++F Sbjct: 27 LIYIILTTSSFRSKASYLQCIQSFAQVF 54 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,794,980 Number of Sequences: 27780 Number of extensions: 136803 Number of successful extensions: 205 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 203 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 205 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 619699724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -