Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ovS301D09f
         (399 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g26790.1 68416.m03351 transcriptional regulator (FUSCA3) iden...    27   4.6  

>At3g26790.1 68416.m03351 transcriptional regulator (FUSCA3)
           identical to FUSCA3 GB:AAC35247 [Arabidopsis thaliana]
           (Plant J. 6, 379-387 (1994))
          Length = 313

 Score = 27.1 bits (57), Expect = 4.6
 Identities = 16/63 (25%), Positives = 28/63 (44%), Gaps = 1/63 (1%)
 Frame = -3

Query: 355 ECRKSLRLDL-NMMRFNVWKLSVAYFSNNSIRIRTC*YPVVFITKRGTFENYLSYFYLRL 179
           EC++ + + + ++  F+VW     Y+ NN+ R+        F+   G         Y  L
Sbjct: 122 ECKEGIPIRMEDLDGFHVWTFKYRYWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDL 181

Query: 178 YSN 170
           YSN
Sbjct: 182 YSN 184


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 6,943,001
Number of Sequences: 28952
Number of extensions: 111776
Number of successful extensions: 190
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 187
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 190
length of database: 12,070,560
effective HSP length: 74
effective length of database: 9,928,112
effective search space used: 575830496
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)