BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301D08f (386 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ278310-1|CAB93496.1| 219|Anopheles gambiae serine protease-li... 27 0.24 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 23 5.1 DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. 22 6.8 AF364132-1|AAL35508.1| 397|Anopheles gambiae putative odorant r... 22 6.8 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 22 6.8 >AJ278310-1|CAB93496.1| 219|Anopheles gambiae serine protease-like protein protein. Length = 219 Score = 27.1 bits (57), Expect = 0.24 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +2 Query: 281 WGITLQEAEIAAKELKIPFFTNKIDDVLLKKNVS 382 WGI E I + +P F IDD L ++N++ Sbjct: 179 WGIGCGEDGIPGVYVNVPMFRGWIDDHLRQRNIT 212 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 22.6 bits (46), Expect = 5.1 Identities = 11/37 (29%), Positives = 24/37 (64%) Frame = +2 Query: 80 RI*NRNLELLHSIKFDCT*HV*SLTLLNVSENKVRTM 190 R+ N+E++ F+ + SL +LN+S+N+++T+ Sbjct: 482 RLTENNIEIIRRGTFEA---MKSLHILNLSQNRLKTV 515 >DQ004399-1|AAY21238.1| 847|Anopheles gambiae lysozyme c-6 protein. Length = 847 Score = 22.2 bits (45), Expect = 6.8 Identities = 9/23 (39%), Positives = 11/23 (47%) Frame = -2 Query: 289 YTPYCFNRKSFLFQERHQNFSNR 221 Y PYC R L++ NF R Sbjct: 766 YRPYCKGRADRLYEFYLNNFGRR 788 >AF364132-1|AAL35508.1| 397|Anopheles gambiae putative odorant receptor Or4 protein. Length = 397 Score = 22.2 bits (45), Expect = 6.8 Identities = 10/30 (33%), Positives = 14/30 (46%) Frame = -2 Query: 364 KDVVNFVCEERNFKFFCGYLCFLQSYTPYC 275 +D + FV CGY+C L+ T C Sbjct: 184 EDYITFVLIMLPVVVMCGYVCNLKVMTICC 213 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 22.2 bits (45), Expect = 6.8 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -2 Query: 274 FNRKSFLFQERHQNFSNRSCS 212 FNR+SF R NF R+ S Sbjct: 313 FNRQSFRVALRANNFQERAVS 333 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 374,049 Number of Sequences: 2352 Number of extensions: 6884 Number of successful extensions: 36 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 36 length of database: 563,979 effective HSP length: 58 effective length of database: 427,563 effective search space used: 29929410 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -