BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301D07f (342 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50147| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_10129| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.3 SB_29698| Best HMM Match : DUF1610 (HMM E-Value=4.6) 27 5.3 SB_24575| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.0 SB_222| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 7.0 SB_26688| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.2 SB_14030| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 9.2 >SB_50147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 739 Score = 28.7 bits (61), Expect = 1.3 Identities = 17/38 (44%), Positives = 20/38 (52%) Frame = +3 Query: 228 RKKREVYDPNIDHHRVKRCCEYEKSRKRRSPAVXAPRQ 341 RKKR + +P I KR E + SRKRRS P Q Sbjct: 496 RKKRSLVEPEIKQKN-KRSLESDISRKRRSLKEGPPSQ 532 >SB_10129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 260 Score = 27.9 bits (59), Expect = 2.3 Identities = 15/41 (36%), Positives = 18/41 (43%) Frame = -2 Query: 233 LPVARIIVIVGLVDIFLFVPRFVDDLSDRDRHQQQPDYRTH 111 L V + +VGL D V FV+ D H Q DY H Sbjct: 40 LKVGTLDTLVGLSDDLNKVDSFVESSVDLSNHAAQNDYNEH 80 >SB_29698| Best HMM Match : DUF1610 (HMM E-Value=4.6) Length = 739 Score = 26.6 bits (56), Expect = 5.3 Identities = 11/32 (34%), Positives = 17/32 (53%) Frame = +2 Query: 26 FNSSYKCNYSEVRY*FAVFNCESALTAQDAFD 121 F S Y+C + R ++ F+C SA T+ D Sbjct: 532 FESDYRCLCEDCRKPYSTFDCGSAATSSRLHD 563 >SB_24575| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1741 Score = 26.2 bits (55), Expect = 7.0 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +3 Query: 219 ASYRKKREVYDPNIDHHRVKRCCEYE 296 AS+ ++R+ +PN+ HH CCE E Sbjct: 1106 ASFGEERQGENPNLKHH---ECCEEE 1128 >SB_222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2323 Score = 26.2 bits (55), Expect = 7.0 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = -2 Query: 245 HFSLLPVARIIVIVGLVDIFLFVPRFVDDLSDR 147 HF L A + V+V ++ + ++ P F+D +SDR Sbjct: 1286 HFFLENPADVPVVVQVLPLSVYPPGFLDVISDR 1318 >SB_26688| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1199 Score = 25.8 bits (54), Expect = 9.2 Identities = 13/55 (23%), Positives = 29/55 (52%), Gaps = 2/55 (3%) Frame = +1 Query: 181 KRKMSTSPTMTMMRATGRREKCMTPTSIIIESNVAVNMKSQE--NDARQLSXHQD 339 +RK++T P +++ + K T + E N+A++ + E + +Q+S +D Sbjct: 772 ERKLNTEPPKVVVKPLTKESKLQTSIRDLKEKNLALSRLNSELQQEVKQVSHARD 826 >SB_14030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 765 Score = 25.8 bits (54), Expect = 9.2 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Frame = +1 Query: 169 NRGTKRKMSTSPTMTMMRATGRRE-KCMTPTSIIIESNVAVNMKSQENDARQL 324 N G+KR SP+ A G+R MTP II ++N V M + +Q+ Sbjct: 621 NPGSKRHAGLSPSELNFPAPGKRPFSSMTPV-IITDNNGNVKMVFGASGGKQI 672 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,269,082 Number of Sequences: 59808 Number of extensions: 94412 Number of successful extensions: 276 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 245 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 276 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 498218920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -