BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301D07f (342 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value L10430-1|AAA27731.1| 150|Apis mellifera transposase protein. 20 9.5 AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase prot... 20 9.5 AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase pr... 20 9.5 >L10430-1|AAA27731.1| 150|Apis mellifera transposase protein. Length = 150 Score = 19.8 bits (39), Expect = 9.5 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -2 Query: 254 GVIHFSLLPVARII 213 G+++F LLP R I Sbjct: 77 GIVYFELLPPNRTI 90 >AY242387-1|AAO72539.2| 693|Apis mellifera prophenoloxidase protein. Length = 693 Score = 19.8 bits (39), Expect = 9.5 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = -2 Query: 242 FSLLPVARIIVIVGLVDIFLFVPRFVDDLS 153 FSL A + L+DIF+ + + D LS Sbjct: 82 FSLFIPAHRKIAARLIDIFMGMRTYEDFLS 111 >AY155490-1|AAO12861.1| 342|Apis mellifera Ammar1 transposase protein. Length = 342 Score = 19.8 bits (39), Expect = 9.5 Identities = 7/14 (50%), Positives = 10/14 (71%) Frame = -2 Query: 254 GVIHFSLLPVARII 213 G+++F LLP R I Sbjct: 198 GIVYFELLPPNRTI 211 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 66,225 Number of Sequences: 438 Number of extensions: 1064 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 50 effective length of database: 124,443 effective search space used: 7839909 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -