BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301D06f (437 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g42270.1 68415.m05232 U5 small nuclear ribonucleoprotein heli... 28 3.2 At4g01810.1 68417.m00238 protein transport protein-related relat... 27 4.2 At1g32200.2 68414.m03961 glycerol-3-phosphate acyltransferase, c... 27 7.3 At1g32200.1 68414.m03960 glycerol-3-phosphate acyltransferase, c... 27 7.3 >At2g42270.1 68415.m05232 U5 small nuclear ribonucleoprotein helicase, putative Length = 2172 Score = 27.9 bits (59), Expect = 3.2 Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = +1 Query: 103 IALVGRRAYGPPDGEWLP-SPMDFSNARGRA 192 + + G + Y P GEW+ SP+D GRA Sbjct: 851 VIIKGTQVYNPERGEWMELSPLDVMQMIGRA 881 >At4g01810.1 68417.m00238 protein transport protein-related related to Sec23 protein [Homo sapiens] gi|1296664|emb|CAA65774 Length = 880 Score = 27.5 bits (58), Expect = 4.2 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = +2 Query: 98 FLLPL*ADEHTAHLMVSGYRRPWTLAMPGAEPSRCL 205 +L P+ A AH + S R P+TL +P A RCL Sbjct: 361 YLSPMHASLKVAHEIFSSLR-PYTLNVPEASRDRCL 395 >At1g32200.2 68414.m03961 glycerol-3-phosphate acyltransferase, chloroplast (ATS1) identical to SP|Q43307|PLSB_ARATH Glycerol-3-phosphate acyltransferase, chloroplast precursor (EC 2.3.1.15) (GPAT) (ATS1) {Arabidopsis thaliana}; contains Pfam profile PF01553: Acyltransferase Length = 459 Score = 26.6 bits (56), Expect = 7.3 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +1 Query: 115 GRRAYGPPDGEWLPSPMDFSN 177 GR P GEW P+P D S+ Sbjct: 324 GRDRPNPSTGEWFPAPFDASS 344 >At1g32200.1 68414.m03960 glycerol-3-phosphate acyltransferase, chloroplast (ATS1) identical to SP|Q43307|PLSB_ARATH Glycerol-3-phosphate acyltransferase, chloroplast precursor (EC 2.3.1.15) (GPAT) (ATS1) {Arabidopsis thaliana}; contains Pfam profile PF01553: Acyltransferase Length = 459 Score = 26.6 bits (56), Expect = 7.3 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = +1 Query: 115 GRRAYGPPDGEWLPSPMDFSN 177 GR P GEW P+P D S+ Sbjct: 324 GRDRPNPSTGEWFPAPFDASS 344 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,843,458 Number of Sequences: 28952 Number of extensions: 132105 Number of successful extensions: 213 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 210 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 213 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 692941200 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -