BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301D04f (358 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11987| Best HMM Match : OTU (HMM E-Value=1.1e-24) 31 0.21 SB_25956| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.5 >SB_11987| Best HMM Match : OTU (HMM E-Value=1.1e-24) Length = 1142 Score = 31.5 bits (68), Expect = 0.21 Identities = 13/31 (41%), Positives = 19/31 (61%) Frame = +3 Query: 84 PHVYKSVQPNGSDLPMNDIPTLRYYYNLGVE 176 P S+ P G+DLP D+ LR++YN G + Sbjct: 868 PAATPSLDPTGADLPQ-DMTVLRFFYNFGYQ 897 >SB_25956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1146 Score = 27.1 bits (57), Expect = 4.5 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +3 Query: 246 HDMQQMSMHDRGMNHNADQXHKHKGGQ 326 HD QQ HD+ H+ Q +H Q Sbjct: 1110 HDQQQQQRHDQQQQHHDQQQQQHHDQQ 1136 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,410,407 Number of Sequences: 59808 Number of extensions: 119743 Number of successful extensions: 359 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 327 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 359 length of database: 16,821,457 effective HSP length: 73 effective length of database: 12,455,473 effective search space used: 560496285 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -