BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301C12f (316 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC644.15 |rpp101|rpp1-1|60S acidic ribosomal protein Rpp1-1|Sc... 86 1e-18 SPBC3B9.13c |rpp102|rpp1-2|60S acidic ribosomal protein Rpp1-2|S... 78 3e-16 SPCP1E11.09c |rpp103|rpp1-3|60S acidic ribosomal protein Rpp1-3|... 73 8e-15 SPAC22F3.05c |alp41||ADP-ribosylation factor Alp41|Schizosacchar... 27 0.89 SPCC16C4.17 |mug123||meiotically upregulated gene Mug123|Schizos... 27 0.89 SPAC144.07c |||conserved eukaryotic protein|Schizosaccharomyces ... 25 3.6 SPAC20G8.02 |||phospholipase|Schizosaccharomyces pombe|chr 1|||M... 25 3.6 SPBC354.15 |fap1||L-pipecolate oxidase|Schizosaccharomyces pombe... 25 3.6 SPBC1709.17 |||folylpolyglutamate synthase|Schizosaccharomyces p... 24 6.3 SPBC649.05 |cut12|stf1|spindle pole body protein Cut12 |Schizosa... 23 8.3 SPBC1826.01c |mot1||TATA-binding protein associated factor Mot1|... 23 8.3 >SPAC644.15 |rpp101|rpp1-1|60S acidic ribosomal protein Rpp1-1|Schizosaccharomyces pombe|chr 1|||Manual Length = 109 Score = 85.8 bits (203), Expect = 1e-18 Identities = 39/70 (55%), Positives = 54/70 (77%) Frame = +2 Query: 38 VSKAELACVYSALILVDDDVAVTGEKISTILKAAAVDVEPYWPGLFAKALEGINVRDLIT 217 +S +ELA YSALIL D+ + +T +K+ ++ KAA VDVEP W +FAKALEG ++++L+ Sbjct: 1 MSASELATSYSALILADEGIEITSDKLLSLTKAANVDVEPIWATIFAKALEGKDLKELLL 60 Query: 218 NIGSGVGAAP 247 NIGSG GAAP Sbjct: 61 NIGSGAGAAP 70 >SPBC3B9.13c |rpp102|rpp1-2|60S acidic ribosomal protein Rpp1-2|Schizosaccharomyces pombe|chr 2|||Manual Length = 110 Score = 78.2 bits (184), Expect = 3e-16 Identities = 38/71 (53%), Positives = 53/71 (74%) Frame = +2 Query: 38 VSKAELACVYSALILVDDDVAVTGEKISTILKAAAVDVEPYWPGLFAKALEGINVRDLIT 217 +S +ELA YSALIL D+ + +T +K+ ++ KAA VDVEP W +FAKALEG ++++L+ Sbjct: 1 MSASELATSYSALILADEGIEITSDKLLSLTKAANVDVEPIWATIFAKALEGKDLKELLL 60 Query: 218 NIGSGVGAAPA 250 NIGS AAPA Sbjct: 61 NIGS-AAAAPA 70 >SPCP1E11.09c |rpp103|rpp1-3|60S acidic ribosomal protein Rpp1-3|Schizosaccharomyces pombe|chr 3|||Manual Length = 109 Score = 73.3 bits (172), Expect = 8e-15 Identities = 34/71 (47%), Positives = 52/71 (73%), Gaps = 1/71 (1%) Frame = +2 Query: 38 VSKAELACVYSALILVDDDVAVTGEKISTILKAAAVDVEPYWPGLFAKALEGINVRDLIT 217 +S +ELA Y+ALIL D+ + +T +K+ ++ KA V+VEP W +FAKALEG ++++L+ Sbjct: 1 MSASELATSYAALILADEGIEITSDKLLSLTKAGNVEVEPIWATIFAKALEGKDLKELLL 60 Query: 218 NIGS-GVGAAP 247 NIGS G +AP Sbjct: 61 NIGSAGAASAP 71 >SPAC22F3.05c |alp41||ADP-ribosylation factor Alp41|Schizosaccharomyces pombe|chr 1|||Manual Length = 186 Score = 26.6 bits (56), Expect = 0.89 Identities = 21/69 (30%), Positives = 35/69 (50%), Gaps = 3/69 (4%) Frame = +2 Query: 20 RSKLKMVSKAELACVYSALILVD-DDV--AVTGEKISTILKAAAVDVEPYWPGLFAKALE 190 R+ L+ + E S L+L + DV A++ E+IS IL + +W AL Sbjct: 103 RNTLQELLVEEKLLFTSILVLANKSDVSGALSSEEISKILNISKYK-SSHWRIFSVSALT 161 Query: 191 GINVRDLIT 217 G+N++D I+ Sbjct: 162 GLNIKDAIS 170 >SPCC16C4.17 |mug123||meiotically upregulated gene Mug123|Schizosaccharomyces pombe|chr 3|||Manual Length = 235 Score = 26.6 bits (56), Expect = 0.89 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 1/37 (2%) Frame = -1 Query: 241 STHSRADVGDQVTDIDAFQG-FGEQTWPIWLYIYSRR 134 S HSRAD + T D F+ G T I Y+ +RR Sbjct: 166 SIHSRADSRAETTQSDGFESRSGSPTHDIQSYLVNRR 202 >SPAC144.07c |||conserved eukaryotic protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 315 Score = 24.6 bits (51), Expect = 3.6 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +2 Query: 2 GLRQLARSKLKMVSKAELACVYSAL 76 G+ QL + ++SKA+L C Y L Sbjct: 159 GMLQLDMPHVNILSKADLLCTYGTL 183 >SPAC20G8.02 |||phospholipase|Schizosaccharomyces pombe|chr 1|||Manual Length = 757 Score = 24.6 bits (51), Expect = 3.6 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -3 Query: 209 GHGH*CLPRLWRTDL 165 G+G CLP LWR D+ Sbjct: 402 GNGVQCLPLLWRQDI 416 >SPBC354.15 |fap1||L-pipecolate oxidase|Schizosaccharomyces pombe|chr 2|||Manual Length = 412 Score = 24.6 bits (51), Expect = 3.6 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = -3 Query: 212 SGHGH*CLPRLWRTDLANMALHLQPPLSRWWKFSHQ 105 SGHG P L + + M L+ PL + W++ + Sbjct: 357 SGHGFKFFPILGKYSIGCMFRELEEPLLKKWRWKKE 392 >SPBC1709.17 |||folylpolyglutamate synthase|Schizosaccharomyces pombe|chr 2|||Manual Length = 505 Score = 23.8 bits (49), Expect = 6.3 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 Query: 152 LHLQPPLSRWWKFS 111 LH+Q L +WWK S Sbjct: 439 LHVQEDLCKWWKES 452 >SPBC649.05 |cut12|stf1|spindle pole body protein Cut12 |Schizosaccharomyces pombe|chr 2|||Manual Length = 548 Score = 23.4 bits (48), Expect = 8.3 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = -2 Query: 237 PTPEPMLVIRSRTLMPSKALANRPGQYGSTSTAAAFKMV 121 PTP P + ++ +PSK + P GS S+A + + Sbjct: 425 PTPAPFSIAAKKSHLPSK--LSFPQDGGSLSSATTLQQL 461 >SPBC1826.01c |mot1||TATA-binding protein associated factor Mot1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1953 Score = 23.4 bits (48), Expect = 8.3 Identities = 12/48 (25%), Positives = 26/48 (54%) Frame = +2 Query: 5 LRQLARSKLKMVSKAELACVYSALILVDDDVAVTGEKISTILKAAAVD 148 +R +A ++++ A + +LV+D V + G+ STI + A++ Sbjct: 1212 VRNMASKCFAAITESNAAGSKALHLLVEDVVPLLGDASSTIHRQGAIE 1259 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,178,444 Number of Sequences: 5004 Number of extensions: 22083 Number of successful extensions: 76 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 72 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 76 length of database: 2,362,478 effective HSP length: 63 effective length of database: 2,047,226 effective search space used: 83936266 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -