BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301C11f (408 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosin... 24 0.50 DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad... 22 2.7 DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 21 3.5 AM292343-1|CAL23155.2| 301|Tribolium castaneum gustatory recept... 21 4.6 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 20 8.1 >AY618898-1|AAU87291.1| 803|Tribolium castaneum receptor tyrosine kinase Torso-likeprotein protein. Length = 803 Score = 24.2 bits (50), Expect = 0.50 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = +1 Query: 97 SRTRIMHKNLKAKEEGQCSNGSCKI 171 ++TR++H++L A+ C N + K+ Sbjct: 609 AKTRVVHRDLAARNVLVCENHTVKV 633 >DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome adhesion molecule splicevariant 3.12.3.1 protein. Length = 1639 Score = 21.8 bits (44), Expect = 2.7 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = -3 Query: 385 ALKRISTLTFSCLNRCQIQNHCCSLNQTRS 296 A KR+STL+ + + N+ C + + S Sbjct: 656 ASKRVSTLSIDNVQSTHVGNYTCLASNSAS 685 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 21.4 bits (43), Expect = 3.5 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +2 Query: 41 SLDTGAMSARANARS*FVLHVHESCIRI*KPKKKVNAA 154 S+D GA+ A ++ +L E C+++ P+K AA Sbjct: 311 SID-GALEAGPYSKEEGLLSYPEVCVKLANPQKLTTAA 347 >AM292343-1|CAL23155.2| 301|Tribolium castaneum gustatory receptor candidate 22 protein. Length = 301 Score = 21.0 bits (42), Expect = 4.6 Identities = 8/18 (44%), Positives = 9/18 (50%) Frame = -3 Query: 184 FSCWVSCSCHCCIDLLLW 131 FS WV C I L+ W Sbjct: 75 FSAWVRCQDQILIFLVNW 92 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 20.2 bits (40), Expect = 8.1 Identities = 6/9 (66%), Positives = 7/9 (77%) Frame = -3 Query: 364 LTFSCLNRC 338 +TF C NRC Sbjct: 1107 ITFGCSNRC 1115 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 67,438 Number of Sequences: 336 Number of extensions: 1155 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8857716 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -