BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301C11f (408 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33392| Best HMM Match : zf-CCHC (HMM E-Value=0.043) 30 0.63 SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.84 SB_22256| Best HMM Match : zf-CCHC (HMM E-Value=0.0025) 29 1.1 SB_11191| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.1 SB_13237| Best HMM Match : zf-CCHC (HMM E-Value=0.0076) 28 2.6 SB_1753| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_7017| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.4 SB_45810| Best HMM Match : Na_Ca_ex (HMM E-Value=0) 27 4.5 SB_34393| Best HMM Match : RVT_1 (HMM E-Value=2e-36) 27 4.5 SB_20246| Best HMM Match : RVT_1 (HMM E-Value=1.4e-30) 27 4.5 SB_16197| Best HMM Match : zf-CCHC (HMM E-Value=0.19) 27 4.5 SB_5719| Best HMM Match : Helicase_C (HMM E-Value=1e-24) 27 4.5 SB_54453| Best HMM Match : PAN (HMM E-Value=3.4e-05) 27 4.5 SB_49565| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.5 SB_16016| Best HMM Match : RVT_1 (HMM E-Value=9.7e-08) 27 5.9 SB_53563| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) 27 5.9 SB_35516| Best HMM Match : Kazal_1 (HMM E-Value=0) 27 5.9 SB_16404| Best HMM Match : RVT_1 (HMM E-Value=9.7e-08) 27 5.9 SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 5.9 SB_7525| Best HMM Match : zf-CCHC (HMM E-Value=1.6e-08) 27 5.9 SB_1231| Best HMM Match : UCH (HMM E-Value=1e-13) 27 5.9 SB_59531| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) 27 7.8 SB_54138| Best HMM Match : rve (HMM E-Value=6.8e-24) 27 7.8 SB_53795| Best HMM Match : rve (HMM E-Value=5.9e-15) 27 7.8 SB_52374| Best HMM Match : GATase_2 (HMM E-Value=0) 27 7.8 SB_51085| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.8 SB_46870| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21) 27 7.8 SB_44609| Best HMM Match : zf-CCHC (HMM E-Value=1.6e-24) 27 7.8 SB_39683| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) 27 7.8 SB_25683| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) 27 7.8 SB_25586| Best HMM Match : RVT_1 (HMM E-Value=2.3e-18) 27 7.8 SB_20121| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.8 SB_15342| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.8 SB_6083| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) 27 7.8 SB_5734| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21) 27 7.8 SB_42776| Best HMM Match : rve (HMM E-Value=1.4e-24) 27 7.8 SB_40058| Best HMM Match : rve (HMM E-Value=5.2e-36) 27 7.8 SB_38523| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.8 SB_33889| Best HMM Match : zf-CCHC (HMM E-Value=2.1e-05) 27 7.8 SB_27417| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) 27 7.8 SB_25715| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) 27 7.8 SB_24493| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) 27 7.8 SB_24279| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.8 SB_23207| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) 27 7.8 SB_22197| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) 27 7.8 SB_16302| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21) 27 7.8 SB_15963| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) 27 7.8 SB_15389| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) 27 7.8 SB_14793| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.8 SB_421| Best HMM Match : RVT_1 (HMM E-Value=2.4e-18) 27 7.8 >SB_33392| Best HMM Match : zf-CCHC (HMM E-Value=0.043) Length = 348 Score = 30.3 bits (65), Expect = 0.63 Identities = 16/47 (34%), Positives = 21/47 (44%) Frame = +1 Query: 34 CLEFGHWSYECKGKRKILVRPSRTRIMHKNLKAKEEGQCSNGSCKIP 174 CL+ GH EC+ K+K + PS H L A +N IP Sbjct: 20 CLKRGHPQRECRSKKKCEIVPSCPYFHHPLLHAHSPPASANAVTPIP 66 >SB_2543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 29.9 bits (64), Expect = 0.84 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +1 Query: 7 FPQGIRCQKCLEFGHWSYEC 66 +P RC +C E GH SYEC Sbjct: 101 YPDKSRCYECGEGGHLSYEC 120 >SB_22256| Best HMM Match : zf-CCHC (HMM E-Value=0.0025) Length = 238 Score = 29.5 bits (63), Expect = 1.1 Identities = 14/36 (38%), Positives = 18/36 (50%) Frame = +1 Query: 25 CQKCLEFGHWSYECKGKRKILVRPSRTRIMHKNLKA 132 C CL+ GH EC+ K+K + PS H L A Sbjct: 19 CFSCLKRGHPQRECRSKKKCEIVPSCPYFPHPLLHA 54 >SB_11191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1577 Score = 29.5 bits (63), Expect = 1.1 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = +1 Query: 22 RCQKCLEFGHWSYECKGK 75 RC +CL H SYECK K Sbjct: 357 RCFRCLRKNHRSYECKSK 374 >SB_13237| Best HMM Match : zf-CCHC (HMM E-Value=0.0076) Length = 558 Score = 28.3 bits (60), Expect = 2.6 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = +1 Query: 13 QGIRCQKCLEFGHWSYECKGKR 78 +G +C KC + GH++ CKG++ Sbjct: 41 RGKKCAKCFKSGHFAACCKGEK 62 >SB_1753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 377 Score = 27.9 bits (59), Expect = 3.4 Identities = 10/21 (47%), Positives = 10/21 (47%) Frame = -3 Query: 346 NRCQIQNHCCSLNQTRSPIHC 284 N C HCC N T IHC Sbjct: 25 NECSAFEHCCKGNCTAKRIHC 45 >SB_7017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1017 Score = 27.9 bits (59), Expect = 3.4 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +1 Query: 19 IRCQKCLEFGHWSYECKGK 75 +RC KC + GH++ C+ K Sbjct: 185 VRCDKCTKVGHFAVVCRSK 203 >SB_45810| Best HMM Match : Na_Ca_ex (HMM E-Value=0) Length = 582 Score = 27.5 bits (58), Expect = 4.5 Identities = 12/24 (50%), Positives = 16/24 (66%), Gaps = 2/24 (8%) Frame = -3 Query: 103 YVKDELGSC--VCPCTHSSSVQTP 38 Y +DE+GS VCPC S++TP Sbjct: 338 YKEDEVGSTMKVCPCLPPVSIETP 361 >SB_34393| Best HMM Match : RVT_1 (HMM E-Value=2e-36) Length = 1198 Score = 27.5 bits (58), Expect = 4.5 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +1 Query: 19 IRCQKCLEFGHWSYECKGK 75 +RC KC + GH++ C+ K Sbjct: 21 VRCDKCTKVGHFAAVCRSK 39 >SB_20246| Best HMM Match : RVT_1 (HMM E-Value=1.4e-30) Length = 1191 Score = 27.5 bits (58), Expect = 4.5 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +1 Query: 19 IRCQKCLEFGHWSYECKGK 75 +RC KC + GH++ C+ K Sbjct: 235 VRCDKCTKVGHFAAVCRSK 253 >SB_16197| Best HMM Match : zf-CCHC (HMM E-Value=0.19) Length = 241 Score = 27.5 bits (58), Expect = 4.5 Identities = 13/37 (35%), Positives = 17/37 (45%) Frame = +1 Query: 25 CQKCLEFGHWSYECKGKRKILVRPSRTRIMHKNLKAK 135 C C + HW CK K K +PS+ + K K K Sbjct: 183 CNSCHKLHHWERVCKSKSK--TQPSKVQHKGKPNKGK 217 >SB_5719| Best HMM Match : Helicase_C (HMM E-Value=1e-24) Length = 1366 Score = 27.5 bits (58), Expect = 4.5 Identities = 8/18 (44%), Positives = 12/18 (66%) Frame = +1 Query: 25 CQKCLEFGHWSYECKGKR 78 C KC + GHW+ C+G + Sbjct: 447 CFKCGQEGHWAKNCRGSK 464 >SB_54453| Best HMM Match : PAN (HMM E-Value=3.4e-05) Length = 82 Score = 27.5 bits (58), Expect = 4.5 Identities = 11/34 (32%), Positives = 16/34 (47%) Frame = -3 Query: 352 CLNRCQIQNHCCSLNQTRSPIHCCCHYQTSSNPP 251 CL RC+++ C SL CC + +T P Sbjct: 31 CLQRCKMETQCQSLGFNVKSSLCCLNNRTVGQRP 64 >SB_49565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1571 Score = 27.5 bits (58), Expect = 4.5 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +1 Query: 19 IRCQKCLEFGHWSYECKGK 75 +RC KC + GH++ C+ K Sbjct: 233 VRCDKCTKVGHFAAVCRSK 251 >SB_16016| Best HMM Match : RVT_1 (HMM E-Value=9.7e-08) Length = 890 Score = 27.1 bits (57), Expect = 5.9 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 19 IRCQKCLEFGHWSYECKGK 75 +RC KC + GH+ C+ K Sbjct: 86 VRCDKCTKVGHFDAVCRSK 104 >SB_53563| Best HMM Match : zf-CCHC (HMM E-Value=0.0048) Length = 168 Score = 27.1 bits (57), Expect = 5.9 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = +1 Query: 31 KCLEFGHWSYECK 69 KCL GHW+ EC+ Sbjct: 24 KCLRVGHWAKECR 36 >SB_35516| Best HMM Match : Kazal_1 (HMM E-Value=0) Length = 320 Score = 27.1 bits (57), Expect = 5.9 Identities = 13/38 (34%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -3 Query: 346 NRCQIQNHCCSLNQTRSPIHC-CCHYQTSSNPPMTNQK 236 N CQ++ C Q +PI C C T +PP + K Sbjct: 43 NECQMRQDACFNKQWTTPISCDPCSNFTCDSPPYSTCK 80 >SB_16404| Best HMM Match : RVT_1 (HMM E-Value=9.7e-08) Length = 765 Score = 27.1 bits (57), Expect = 5.9 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = +1 Query: 19 IRCQKCLEFGHWSYECKGK 75 +RC KC + GH+ C+ K Sbjct: 68 VRCDKCTKVGHFDAVCRSK 86 >SB_7591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3261 Score = 27.1 bits (57), Expect = 5.9 Identities = 13/38 (34%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = -3 Query: 346 NRCQIQNHCCSLNQTRSPIHC-CCHYQTSSNPPMTNQK 236 N CQ++ C Q +PI C C T +PP + K Sbjct: 1017 NECQMRQDACFNKQWTTPISCDPCSNFTCDSPPYSTCK 1054 >SB_7525| Best HMM Match : zf-CCHC (HMM E-Value=1.6e-08) Length = 256 Score = 27.1 bits (57), Expect = 5.9 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +1 Query: 19 IRCQKCLEFGHWSYEC 66 I C+KC E GH S++C Sbjct: 125 IECRKCKERGHISFDC 140 >SB_1231| Best HMM Match : UCH (HMM E-Value=1e-13) Length = 969 Score = 27.1 bits (57), Expect = 5.9 Identities = 12/54 (22%), Positives = 25/54 (46%) Frame = +1 Query: 25 CQKCLEFGHWSYECKGKRKILVRPSRTRIMHKNLKAKEEGQCSNGSCKIPNKKK 186 C KC +R L+ S++ +H+N+ A++EG C + + ++ Sbjct: 188 CDKCQIEQPEDKRDSDQRSDLIHSSQSEAVHRNVHAEDEGHIDEYGCGLHDNEQ 241 >SB_59531| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) Length = 323 Score = 26.6 bits (56), Expect = 7.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 25 CQKCLEFGHWSYECKGK 75 C KC + GH++ CKGK Sbjct: 28 CNKCQKKGHFAKVCKGK 44 >SB_54138| Best HMM Match : rve (HMM E-Value=6.8e-24) Length = 2160 Score = 26.6 bits (56), Expect = 7.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 25 CQKCLEFGHWSYECKGK 75 C KC + GH++ CKGK Sbjct: 233 CNKCQKKGHFAKVCKGK 249 >SB_53795| Best HMM Match : rve (HMM E-Value=5.9e-15) Length = 615 Score = 26.6 bits (56), Expect = 7.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 25 CQKCLEFGHWSYECKGK 75 C KC + GH++ CKGK Sbjct: 138 CNKCQKKGHFAKVCKGK 154 >SB_52374| Best HMM Match : GATase_2 (HMM E-Value=0) Length = 1075 Score = 26.6 bits (56), Expect = 7.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 25 CQKCLEFGHWSYECKGK 75 C KC + GH++ CKGK Sbjct: 141 CNKCQKKGHFAKVCKGK 157 >SB_51085| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1251 Score = 26.6 bits (56), Expect = 7.8 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +1 Query: 19 IRCQKCLEFGHWSYECKGK 75 +RC KC + GH++ C+ K Sbjct: 242 VRCDKCNKVGHFAAVCRSK 260 >SB_46870| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21) Length = 998 Score = 26.6 bits (56), Expect = 7.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 25 CQKCLEFGHWSYECKGK 75 C KC + GH++ CKGK Sbjct: 233 CNKCQKKGHFAKVCKGK 249 >SB_44609| Best HMM Match : zf-CCHC (HMM E-Value=1.6e-24) Length = 283 Score = 26.6 bits (56), Expect = 7.8 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +1 Query: 4 AFPQGIRCQKCLEFGHWSYECKGKRK 81 A QG+ C C E GH + +C +K Sbjct: 134 AVAQGVTCFHCRELGHRAADCPQTKK 159 >SB_39683| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) Length = 579 Score = 26.6 bits (56), Expect = 7.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 25 CQKCLEFGHWSYECKGK 75 C KC + GH++ CKGK Sbjct: 197 CNKCQKKGHFAKVCKGK 213 >SB_25683| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) Length = 249 Score = 26.6 bits (56), Expect = 7.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 25 CQKCLEFGHWSYECKGK 75 C KC + GH++ CKGK Sbjct: 76 CNKCQKKGHFAKVCKGK 92 >SB_25586| Best HMM Match : RVT_1 (HMM E-Value=2.3e-18) Length = 802 Score = 26.6 bits (56), Expect = 7.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 25 CQKCLEFGHWSYECKGK 75 C KC + GH++ CKGK Sbjct: 125 CNKCQKKGHFAKVCKGK 141 >SB_20121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2306 Score = 26.6 bits (56), Expect = 7.8 Identities = 13/43 (30%), Positives = 22/43 (51%) Frame = +1 Query: 13 QGIRCQKCLEFGHWSYECKGKRKILVRPSRTRIMHKNLKAKEE 141 +G C KC E GH++ K K K R ++ + H+ + +E Sbjct: 1546 RGRMCNKCGEIGHFAKFAKAKSKTAERKNKGTV-HQLTEESDE 1587 >SB_15342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1434 Score = 26.6 bits (56), Expect = 7.8 Identities = 10/25 (40%), Positives = 11/25 (44%) Frame = -3 Query: 358 FSCLNRCQIQNHCCSLNQTRSPIHC 284 + CL CQ HC S N R C Sbjct: 433 YDCLLACQANPHCVSYNYRRDKQEC 457 >SB_6083| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) Length = 176 Score = 26.6 bits (56), Expect = 7.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 25 CQKCLEFGHWSYECKGK 75 C KC + GH++ CKGK Sbjct: 76 CNKCQKKGHFAKVCKGK 92 >SB_5734| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21) Length = 508 Score = 26.6 bits (56), Expect = 7.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 25 CQKCLEFGHWSYECKGK 75 C KC + GH++ CKGK Sbjct: 28 CNKCQKKGHFAKVCKGK 44 >SB_42776| Best HMM Match : rve (HMM E-Value=1.4e-24) Length = 627 Score = 26.6 bits (56), Expect = 7.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 25 CQKCLEFGHWSYECKGK 75 C KC + GH++ CKGK Sbjct: 65 CNKCQKKGHFAKVCKGK 81 >SB_40058| Best HMM Match : rve (HMM E-Value=5.2e-36) Length = 1048 Score = 26.6 bits (56), Expect = 7.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 25 CQKCLEFGHWSYECKGK 75 C KC + GH++ CKGK Sbjct: 233 CNKCQKKGHFAKVCKGK 249 >SB_38523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1258 Score = 26.6 bits (56), Expect = 7.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 25 CQKCLEFGHWSYECKGK 75 C KC + GH++ CKGK Sbjct: 417 CNKCQKKGHFAKVCKGK 433 >SB_33889| Best HMM Match : zf-CCHC (HMM E-Value=2.1e-05) Length = 525 Score = 26.6 bits (56), Expect = 7.8 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +1 Query: 13 QGIRCQKCLEFGHWSYECK 69 +G+RC C +FGH +C+ Sbjct: 252 KGLRCYHCHKFGHIKRDCR 270 >SB_27417| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) Length = 538 Score = 26.6 bits (56), Expect = 7.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 25 CQKCLEFGHWSYECKGK 75 C KC + GH++ CKGK Sbjct: 354 CNKCQKKGHFAKVCKGK 370 >SB_25715| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) Length = 270 Score = 26.6 bits (56), Expect = 7.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 25 CQKCLEFGHWSYECKGK 75 C KC + GH++ CKGK Sbjct: 28 CNKCQKKGHFAKVCKGK 44 >SB_24493| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) Length = 176 Score = 26.6 bits (56), Expect = 7.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 25 CQKCLEFGHWSYECKGK 75 C KC + GH++ CKGK Sbjct: 76 CNKCQKKGHFAKVCKGK 92 >SB_24279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1095 Score = 26.6 bits (56), Expect = 7.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 25 CQKCLEFGHWSYECKGK 75 C KC + GH++ CKGK Sbjct: 233 CNKCQKKGHFAKVCKGK 249 >SB_23207| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) Length = 260 Score = 26.6 bits (56), Expect = 7.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 25 CQKCLEFGHWSYECKGK 75 C KC + GH++ CKGK Sbjct: 76 CNKCQKKGHFAKVCKGK 92 >SB_22197| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) Length = 528 Score = 26.6 bits (56), Expect = 7.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 25 CQKCLEFGHWSYECKGK 75 C KC + GH++ CKGK Sbjct: 233 CNKCQKKGHFAKVCKGK 249 >SB_16302| Best HMM Match : RVT_1 (HMM E-Value=1.6e-21) Length = 870 Score = 26.6 bits (56), Expect = 7.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 25 CQKCLEFGHWSYECKGK 75 C KC + GH++ CKGK Sbjct: 233 CNKCQKKGHFAKVCKGK 249 >SB_15963| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) Length = 434 Score = 26.6 bits (56), Expect = 7.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 25 CQKCLEFGHWSYECKGK 75 C KC + GH++ CKGK Sbjct: 218 CNKCQKKGHFAKVCKGK 234 >SB_15389| Best HMM Match : zf-CCHC (HMM E-Value=0.00021) Length = 462 Score = 26.6 bits (56), Expect = 7.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 25 CQKCLEFGHWSYECKGK 75 C KC + GH++ CKGK Sbjct: 353 CNKCQKKGHFAKVCKGK 369 >SB_14793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 821 Score = 26.6 bits (56), Expect = 7.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 25 CQKCLEFGHWSYECKGK 75 C KC + GH++ CKGK Sbjct: 517 CNKCQKKGHFAKVCKGK 533 >SB_421| Best HMM Match : RVT_1 (HMM E-Value=2.4e-18) Length = 1046 Score = 26.6 bits (56), Expect = 7.8 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +1 Query: 25 CQKCLEFGHWSYECKGK 75 C KC + GH++ CKGK Sbjct: 578 CNKCQKKGHFAKVCKGK 594 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,093,392 Number of Sequences: 59808 Number of extensions: 151889 Number of successful extensions: 1029 Number of sequences better than 10.0: 50 Number of HSP's better than 10.0 without gapping: 957 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1026 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 740151420 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -