BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301C10f (388 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g49950.1 68418.m06185 embryogenesis-associated protein-relate... 27 3.3 At1g28580.2 68414.m03519 GDSL-motif lipase, putative similar to ... 27 3.3 At1g28580.1 68414.m03520 GDSL-motif lipase, putative similar to ... 27 3.3 >At5g49950.1 68418.m06185 embryogenesis-associated protein-related contains weak similarity to Embryogenesis-associated protein EMB8 (Swiss-Prot:Q40863) [Picea glauca] Length = 537 Score = 27.5 bits (58), Expect = 3.3 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = -3 Query: 335 ILFTSSNHSSYSKLYDALTNSIKWCTKLIH 246 I+ ++ H + Y+ LT S W T+++H Sbjct: 374 IVLATTTHGGHLAYYEGLTASSMWWTRVVH 403 >At1g28580.2 68414.m03519 GDSL-motif lipase, putative similar to lipase [Arabidopsis thaliana] GI:1145627; contains InterPro Entry IPR001087 Lipolytic enzyme, G-D-S-L family Length = 309 Score = 27.5 bits (58), Expect = 3.3 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = -3 Query: 359 PFGVSVFVILFTSSNHSSYSKLYDALTNSIKWCTK 255 P G SV L+ +S+ +S + YD LT +KW K Sbjct: 148 PVGCSV---LYLTSHQTSNMEEYDPLTGCLKWLNK 179 >At1g28580.1 68414.m03520 GDSL-motif lipase, putative similar to lipase [Arabidopsis thaliana] GI:1145627; contains InterPro Entry IPR001087 Lipolytic enzyme, G-D-S-L family Length = 390 Score = 27.5 bits (58), Expect = 3.3 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = -3 Query: 359 PFGVSVFVILFTSSNHSSYSKLYDALTNSIKWCTK 255 P G SV L+ +S+ +S + YD LT +KW K Sbjct: 229 PVGCSV---LYLTSHQTSNMEEYDPLTGCLKWLNK 260 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,490,623 Number of Sequences: 28952 Number of extensions: 131717 Number of successful extensions: 362 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 334 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 362 length of database: 12,070,560 effective HSP length: 73 effective length of database: 9,957,064 effective search space used: 547638520 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -