BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301C09f (315 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 30 0.005 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 30 0.005 EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopre... 21 3.1 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 21 4.0 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 20 5.4 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 20 5.4 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 20 5.4 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 20 5.4 L01617-1|AAA30097.1| 46|Tribolium castaneum zinc finger protei... 20 7.1 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 19 9.4 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 30.3 bits (65), Expect = 0.005 Identities = 19/52 (36%), Positives = 29/52 (55%) Frame = +1 Query: 70 WWFIFLKMASVATVTRALLGKNVLNKCKVVSATSQASIKFYSTASYENIKVE 225 W FLK+ ++ TV +LG V++K + TSQ IK T +Y N K++ Sbjct: 55 WGVKFLKVVTIITVFFVVLGAAVVSKGTTLFMTSQ--IKKNVTRAYCNKKID 104 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 30.3 bits (65), Expect = 0.005 Identities = 19/52 (36%), Positives = 29/52 (55%) Frame = +1 Query: 70 WWFIFLKMASVATVTRALLGKNVLNKCKVVSATSQASIKFYSTASYENIKVE 225 W FLK+ ++ TV +LG V++K + TSQ IK T +Y N K++ Sbjct: 55 WGVKFLKVVTIITVFFVVLGAAVVSKGTTLFMTSQ--IKKNVTRAYCNKKID 104 >EF222295-1|ABN79655.1| 146|Tribolium castaneum arginine vasopressin-like peptide protein. Length = 146 Score = 21.0 bits (42), Expect = 3.1 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = +3 Query: 90 NGFCRYCNSCFAGKECTEQVQSGI 161 +G C +SC A K C +S I Sbjct: 107 DGICCSQDSCHADKSCASDDKSPI 130 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 20.6 bits (41), Expect = 4.0 Identities = 7/20 (35%), Positives = 10/20 (50%) Frame = +1 Query: 7 HECHTRRCLCPYH*YCINPS 66 H H + PYH +NP+ Sbjct: 41 HSPHLNHAMHPYHANHVNPT 60 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 20.2 bits (40), Expect = 5.4 Identities = 8/39 (20%), Positives = 19/39 (48%) Frame = +1 Query: 28 CLCPYH*YCINPSTWWFIFLKMASVATVTRALLGKNVLN 144 CL P +CI P + + + + + +++ NV++ Sbjct: 1020 CLHPQEFWCIVPGIIYLLSIPSMYLLLILYSIINLNVVS 1058 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 20.2 bits (40), Expect = 5.4 Identities = 8/39 (20%), Positives = 19/39 (48%) Frame = +1 Query: 28 CLCPYH*YCINPSTWWFIFLKMASVATVTRALLGKNVLN 144 CL P +CI P + + + + + +++ NV++ Sbjct: 1020 CLHPQEFWCIVPGIIYLLSIPSMYLLLILYSIINLNVVS 1058 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 20.2 bits (40), Expect = 5.4 Identities = 8/39 (20%), Positives = 19/39 (48%) Frame = +1 Query: 28 CLCPYH*YCINPSTWWFIFLKMASVATVTRALLGKNVLN 144 CL P +CI P + + + + + +++ NV++ Sbjct: 1020 CLHPQEFWCIVPGIIYLLSIPSMYLLLILYSIINLNVVS 1058 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 20.2 bits (40), Expect = 5.4 Identities = 8/39 (20%), Positives = 19/39 (48%) Frame = +1 Query: 28 CLCPYH*YCINPSTWWFIFLKMASVATVTRALLGKNVLN 144 CL P +CI P + + + + + +++ NV++ Sbjct: 1020 CLHPQEFWCIVPGIIYLLSIPSMYLLLILYSIINLNVVS 1058 >L01617-1|AAA30097.1| 46|Tribolium castaneum zinc finger protein protein. Length = 46 Score = 19.8 bits (39), Expect = 7.1 Identities = 6/9 (66%), Positives = 6/9 (66%) Frame = +3 Query: 99 CRYCNSCFA 125 C YCN FA Sbjct: 38 CTYCNRAFA 46 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 19.4 bits (38), Expect = 9.4 Identities = 5/5 (100%), Positives = 5/5 (100%) Frame = +1 Query: 61 PSTWW 75 PSTWW Sbjct: 1039 PSTWW 1043 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 72,430 Number of Sequences: 336 Number of extensions: 1374 Number of successful extensions: 10 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 49 effective length of database: 106,121 effective search space used: 5836655 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -