BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301C06f (429 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF022980-11|AAG24189.1| 330|Caenorhabditis elegans Serpentine r... 27 4.3 U80839-3|AAB37909.1| 344|Caenorhabditis elegans Serpentine rece... 26 10.0 AL023842-7|CAA19518.3| 345|Caenorhabditis elegans Hypothetical ... 26 10.0 AB108783-1|BAC75705.1| 345|Caenorhabditis elegans SDF-9 protein... 26 10.0 >AF022980-11|AAG24189.1| 330|Caenorhabditis elegans Serpentine receptor, class j protein49 protein. Length = 330 Score = 27.5 bits (58), Expect = 4.3 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = -1 Query: 348 FSNYVKPHLFGTIHHFLRAKLHFLLN*IQIDFHPICYCLF 229 F NY LF + + + + ++FL IQID H YC F Sbjct: 37 FGNYRFLLLFFAVFNMIYSVMNFL---IQIDIHSYRYCFF 73 >U80839-3|AAB37909.1| 344|Caenorhabditis elegans Serpentine receptor, class h protein72 protein. Length = 344 Score = 26.2 bits (55), Expect = 10.0 Identities = 15/41 (36%), Positives = 21/41 (51%) Frame = +1 Query: 79 FLALCKIYKLNVMN*KTDMFLARNLAFQRKSFQNLIVKNKI 201 F C IY L ++ KTD A+ Q +SF LI++ I Sbjct: 229 FFTSCCIYYLVIV--KTDQVSAQTRRIQARSFYGLIIQTLI 267 >AL023842-7|CAA19518.3| 345|Caenorhabditis elegans Hypothetical protein Y44A6D.4 protein. Length = 345 Score = 26.2 bits (55), Expect = 10.0 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +3 Query: 18 ELQKYVVTSTFFLKEFNLRKFL 83 E++K++ T T+FL E + KFL Sbjct: 316 EIEKFINTKTWFLNESSRNKFL 337 >AB108783-1|BAC75705.1| 345|Caenorhabditis elegans SDF-9 protein protein. Length = 345 Score = 26.2 bits (55), Expect = 10.0 Identities = 10/22 (45%), Positives = 16/22 (72%) Frame = +3 Query: 18 ELQKYVVTSTFFLKEFNLRKFL 83 E++K++ T T+FL E + KFL Sbjct: 316 EIEKFINTKTWFLNESSRNKFL 337 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,485,203 Number of Sequences: 27780 Number of extensions: 145558 Number of successful extensions: 323 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 317 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 323 length of database: 12,740,198 effective HSP length: 75 effective length of database: 10,656,698 effective search space used: 713998766 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -