BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301C05f (403 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY071712-1|AAL49334.1| 51|Drosophila melanogaster RH27094p pro... 94 7e-20 AE013599-3798|AAF47154.1| 51|Drosophila melanogaster CG3997-PA... 94 7e-20 AF012422-1|AAB65802.1| 51|Drosophila melanogaster ribosomal pr... 91 4e-19 BT016042-1|AAV36927.1| 501|Drosophila melanogaster LP20978p pro... 63 1e-10 AE014134-545|AAF51155.1| 501|Drosophila melanogaster CG17259-PA... 63 1e-10 >AY071712-1|AAL49334.1| 51|Drosophila melanogaster RH27094p protein. Length = 51 Score = 93.9 bits (223), Expect = 7e-20 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = -1 Query: 193 KTFIIKRKLAKKLKQNRPIPQWVRMRTGNTIRYNAKRRHWRRTKLKL 53 K+F IK+KLAKKLKQNR +PQWVR+RTGNTIRYNAKRRHWRRTKLKL Sbjct: 5 KSFRIKQKLAKKLKQNRSVPQWVRLRTGNTIRYNAKRRHWRRTKLKL 51 >AE013599-3798|AAF47154.1| 51|Drosophila melanogaster CG3997-PA protein. Length = 51 Score = 93.9 bits (223), Expect = 7e-20 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = -1 Query: 193 KTFIIKRKLAKKLKQNRPIPQWVRMRTGNTIRYNAKRRHWRRTKLKL 53 K+F IK+KLAKKLKQNR +PQWVR+RTGNTIRYNAKRRHWRRTKLKL Sbjct: 5 KSFRIKQKLAKKLKQNRSVPQWVRLRTGNTIRYNAKRRHWRRTKLKL 51 >AF012422-1|AAB65802.1| 51|Drosophila melanogaster ribosomal protein 46 protein. Length = 51 Score = 91.5 bits (217), Expect = 4e-19 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = -1 Query: 193 KTFIIKRKLAKKLKQNRPIPQWVRMRTGNTIRYNAKRRHWRRTKLKL 53 K+F IK+KLAKKLKQNR +PQWVR+ TGNTIRYNAKRRHWRRTKLKL Sbjct: 5 KSFRIKQKLAKKLKQNRSVPQWVRLATGNTIRYNAKRRHWRRTKLKL 51 >BT016042-1|AAV36927.1| 501|Drosophila melanogaster LP20978p protein. Length = 501 Score = 63.3 bits (147), Expect = 1e-10 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +1 Query: 298 MVLDLDLFRADKDGNPDKIRENQKKRFKDVALXD 399 MVLDLDLFR+DK GNPD +RENQKKRFKDVAL + Sbjct: 1 MVLDLDLFRSDKGGNPDLVRENQKKRFKDVALVE 34 >AE014134-545|AAF51155.1| 501|Drosophila melanogaster CG17259-PA protein. Length = 501 Score = 63.3 bits (147), Expect = 1e-10 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +1 Query: 298 MVLDLDLFRADKDGNPDKIRENQKKRFKDVALXD 399 MVLDLDLFR+DK GNPD +RENQKKRFKDVAL + Sbjct: 1 MVLDLDLFRSDKGGNPDLVRENQKKRFKDVALVE 34 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,502,854 Number of Sequences: 53049 Number of extensions: 310848 Number of successful extensions: 705 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 696 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 705 length of database: 24,988,368 effective HSP length: 77 effective length of database: 20,903,595 effective search space used: 1170601320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -