BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301C03f (373 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_27207| Best HMM Match : eIF-5a (HMM E-Value=3.1e-15) 98 3e-28 SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) 31 0.39 SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.39 SB_5387| Best HMM Match : DNA_pol_E_B (HMM E-Value=9.2e-35) 25 0.71 SB_579| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.2 SB_12083| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) 28 2.8 SB_6893| Best HMM Match : PPV_E2_C (HMM E-Value=0.94) 28 2.8 SB_26376| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.7 SB_16428| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 3.7 SB_42643| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.9 SB_49607| Best HMM Match : No HMM Matches (HMM E-Value=.) 24 6.1 SB_52495| Best HMM Match : AT_hook (HMM E-Value=4.6) 27 6.4 SB_37509| Best HMM Match : PAE (HMM E-Value=0) 27 6.4 SB_31608| Best HMM Match : DUF298 (HMM E-Value=3.9) 27 6.4 SB_59641| Best HMM Match : PAE (HMM E-Value=0) 27 6.4 SB_37798| Best HMM Match : Sec15 (HMM E-Value=1.8) 27 6.4 SB_30225| Best HMM Match : Peptidase_S8 (HMM E-Value=0.0034) 27 6.4 SB_1052| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.4 SB_54310| Best HMM Match : Aa_trans (HMM E-Value=1.9e-23) 26 8.5 SB_40632| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.5 SB_38795| Best HMM Match : M (HMM E-Value=2.4e-07) 26 8.5 SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) 23 9.1 >SB_27207| Best HMM Match : eIF-5a (HMM E-Value=3.1e-15) Length = 710 Score = 98.3 bits (234), Expect(2) = 3e-28 Identities = 42/56 (75%), Positives = 50/56 (89%) Frame = +3 Query: 12 DIEDTHFETGDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKTGKHGHAKV 179 ++ DT F +G+SGAS T+P QCS+LRKNG V++KGRPCKIVEMSTSKTGKHGHAKV Sbjct: 589 ELADTEFHSGESGASDTYPAQCSSLRKNGHVVIKGRPCKIVEMSTSKTGKHGHAKV 644 Score = 43.6 bits (98), Expect(2) = 3e-28 Identities = 17/31 (54%), Positives = 24/31 (77%) Frame = +3 Query: 279 QLTDISDDGYLTLMADNGDLREDLKIPDGDL 371 ++T+I +DGYL LM DNGD R D+K+ D D+ Sbjct: 643 KVTNIEEDGYLELMDDNGDTRADIKLQDNDI 673 >SB_14043| Best HMM Match : Extensin_1 (HMM E-Value=0.75) Length = 568 Score = 30.7 bits (66), Expect = 0.39 Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +1 Query: 13 TSKTHTSRPETPGPQPPSPCNVRPCVKTVSLC*RVVH-ARLLKCPH 147 T+K HT++P T P P N+ P + + +L ++H + PH Sbjct: 168 TTKPHTTKPHTTKPHTTKPHNIDPTLPSPTLLNALLHFLYFYQAPH 213 Score = 27.5 bits (58), Expect = 3.7 Identities = 10/24 (41%), Positives = 14/24 (58%) Frame = +1 Query: 13 TSKTHTSRPETPGPQPPSPCNVRP 84 T+K HT++P T PQ P +P Sbjct: 68 TTKPHTTKPRTTKPQTTKPHTTKP 91 Score = 27.1 bits (57), Expect = 4.9 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +1 Query: 13 TSKTHTSRPETPGPQPPSPCNVRPC 87 T+K +T++P T P+ P +PC Sbjct: 108 TNKPYTTKPRTTKPRTTKPHTTKPC 132 Score = 27.1 bits (57), Expect = 4.9 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = +1 Query: 13 TSKTHTSRPETPGPQPPSPCNVRP 84 T+K T++P T P PC +P Sbjct: 113 TTKPRTTKPRTTKPHTTKPCTTKP 136 >SB_53582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 393 Score = 30.7 bits (66), Expect = 0.39 Identities = 19/52 (36%), Positives = 25/52 (48%) Frame = +1 Query: 1 QQWVTSKTHTSRPETPGPQPPSPCNVRPCVKTVSLC*RVVHARLLKCPHPKP 156 +Q V S P P P PP+PC + PC +T +VVH+ L P P Sbjct: 126 EQHVVSHVMHPAPPPPPPPPPAPC-MPPCHQT-----QVVHSVQLHASPPGP 171 >SB_5387| Best HMM Match : DNA_pol_E_B (HMM E-Value=9.2e-35) Length = 458 Score = 24.6 bits (51), Expect(2) = 0.71 Identities = 13/53 (24%), Positives = 26/53 (49%) Frame = +1 Query: 64 SPCNVRPCVKTVSLC*RVVHARLLKCPHPKPESTATLKFTWLGLISSMVKSMK 222 +PC ++ C + +S+ V ++K P P TL ++G + +K +K Sbjct: 398 NPCRIQYCTQEISMTPIHVLLLIVKAPILDPSLVVTLCSRFIGHQARKLKIVK 450 Score = 23.8 bits (49), Expect(2) = 0.71 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +1 Query: 46 PGPQPPSPCNVRP 84 PGPQ P P N+ P Sbjct: 362 PGPQDPGPGNILP 374 >SB_579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 29.1 bits (62), Expect = 1.2 Identities = 16/41 (39%), Positives = 23/41 (56%), Gaps = 1/41 (2%) Frame = +3 Query: 90 KNGFVMLKGRPCKIV-EMSTSKTGKHGHAKVHLVGIDIFNG 209 + G +M +G+PCKI + K G HG +H+ G D NG Sbjct: 17 RRGVMMAEGKPCKITGTIEGLKAGNHGF-HIHVYG-DNTNG 55 >SB_12083| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1671 Score = 28.7 bits (61), Expect = 1.6 Identities = 16/43 (37%), Positives = 18/43 (41%) Frame = +3 Query: 204 NGKKYEDICPSTHNMDVPHVKREDYQLTDISDDGYLTLMADNG 332 NG Y CP N D + EDY + D YLT D G Sbjct: 400 NGHTYHMTCPGQTNFDPAKKRCEDYDCSG-RDVAYLTDQNDGG 441 >SB_37008| Best HMM Match : MAM (HMM E-Value=1.3999e-42) Length = 382 Score = 27.9 bits (59), Expect = 2.8 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = +1 Query: 16 SKTHTSRPETPGPQPPSPCNV 78 ++T T++PET P+PP+P + Sbjct: 165 TETTTTKPETKPPKPPAPSTI 185 >SB_6893| Best HMM Match : PPV_E2_C (HMM E-Value=0.94) Length = 1058 Score = 27.9 bits (59), Expect = 2.8 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = +1 Query: 10 VTSKTHTSRPETPGPQPPSPCNVRP 84 VT K T +P TP P P P RP Sbjct: 768 VTPKPVTPKPVTPKPVTPKPVTTRP 792 >SB_26376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1018 Score = 27.5 bits (58), Expect = 3.7 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = +1 Query: 16 SKTHTSRPETPGPQPPSP 69 ++T T +P TP P PP+P Sbjct: 288 TRTPTPKPRTPTPSPPTP 305 >SB_16428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1005 Score = 27.5 bits (58), Expect = 3.7 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +1 Query: 31 SRPETPGPQPPSPCNVRP 84 +RP TPG +PP P N P Sbjct: 166 TRPTTPGMRPPEPINDAP 183 >SB_42643| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 557 Score = 27.1 bits (57), Expect = 4.9 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = -2 Query: 315 GSGSHHPRYQSVGSLRASRGVRPC-CVWRDRYL 220 G+GS HP Y +V V PC C W+ + L Sbjct: 517 GAGSPHPHYHAVQGANGQYSV-PCNCTWQPQDL 548 >SB_49607| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4538 Score = 23.8 bits (49), Expect(2) = 6.1 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = +1 Query: 16 SKTHTSRPETPGPQPPSPCNVRPCV 90 SK+H + T GP+ SP N R + Sbjct: 4412 SKSHPMQARTQGPRTHSPYNGRKSI 4436 Score = 21.0 bits (42), Expect(2) = 6.1 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +1 Query: 136 KCPHPKPESTATLKFTWLGLISSMVKSMK 222 K P P ++ FTW ISS+ SM+ Sbjct: 4474 KNPGYGPAKELSIAFTWGFSISSLRSSMQ 4502 >SB_52495| Best HMM Match : AT_hook (HMM E-Value=4.6) Length = 183 Score = 26.6 bits (56), Expect = 6.4 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -1 Query: 121 GRPFSITKPFLRRAEHCMGKVAEAPE 44 GRP +P L EHC GK+ E P+ Sbjct: 134 GRPRE--QPVLAEVEHCHGKLTERPK 157 >SB_37509| Best HMM Match : PAE (HMM E-Value=0) Length = 483 Score = 26.6 bits (56), Expect = 6.4 Identities = 10/48 (20%), Positives = 19/48 (39%) Frame = +1 Query: 112 RVVHARLLKCPHPKPESTATLKFTWLGLISSMVKSMKISVPPHTTWTY 255 +++H R + C P ++ + L V + PH +W Y Sbjct: 334 QIIHVRGVSCEPPDYREAQRMRTNSIDLTRGHVSRRSLPNKPHPSWAY 381 >SB_31608| Best HMM Match : DUF298 (HMM E-Value=3.9) Length = 203 Score = 26.6 bits (56), Expect = 6.4 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = -1 Query: 121 GRPFSITKPFLRRAEHCMGKVAEAPE 44 GRP +P L EHC GK+ E P+ Sbjct: 154 GRPRE--QPVLAEVEHCHGKLTERPK 177 >SB_59641| Best HMM Match : PAE (HMM E-Value=0) Length = 1252 Score = 26.6 bits (56), Expect = 6.4 Identities = 10/48 (20%), Positives = 19/48 (39%) Frame = +1 Query: 112 RVVHARLLKCPHPKPESTATLKFTWLGLISSMVKSMKISVPPHTTWTY 255 +++H R + C P ++ + L V + PH +W Y Sbjct: 1103 QIIHVRGVSCEPPDYREAQRMRTNSIDLTRGHVSRRSLPNKPHPSWAY 1150 >SB_37798| Best HMM Match : Sec15 (HMM E-Value=1.8) Length = 1007 Score = 26.6 bits (56), Expect = 6.4 Identities = 15/36 (41%), Positives = 20/36 (55%) Frame = -1 Query: 256 GTSMLCVEGQISSYFLPLKISIPTK*TLAWPCFPVL 149 GT L +GQ+S +FL + IS P L CF +L Sbjct: 962 GTDKLISDGQVSHFFL-IDISYPCNVLLDKDCFILL 996 >SB_30225| Best HMM Match : Peptidase_S8 (HMM E-Value=0.0034) Length = 605 Score = 26.6 bits (56), Expect = 6.4 Identities = 9/17 (52%), Positives = 10/17 (58%) Frame = +1 Query: 19 KTHTSRPETPGPQPPSP 69 K H +P P P PPSP Sbjct: 344 KEHPDKPRDPAPVPPSP 360 >SB_1052| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1092 Score = 26.6 bits (56), Expect = 6.4 Identities = 28/123 (22%), Positives = 50/123 (40%), Gaps = 8/123 (6%) Frame = +3 Query: 24 THFETGDSGASATFPMQCSALRKNGFVMLKGRPCKIVEMSTSKT-----GKHGHAKVHLV 188 T E+G + P QC+ + F+ RP + + S ++ G + L Sbjct: 865 TRRESGQRVSHGLSPKQCAVSVVSSFMDSGARPRRFLPGSQARPRRFLPGSQPRPRRFLP 924 Query: 189 GIDIFNGKKYE--DICPSTHNMDVPHVKREDYQLTDISD-DGYLTLMADNGDLREDLKIP 359 + + G Y ++ P +D+ + Y++ ++ D YL L D GD LK+ Sbjct: 925 VLKLDPGDFYRVLNLDPGDFYLDLKLDPGDFYRVLNLDPGDFYLDLKLDPGDFYPVLKLD 984 Query: 360 DGD 368 GD Sbjct: 985 PGD 987 >SB_54310| Best HMM Match : Aa_trans (HMM E-Value=1.9e-23) Length = 977 Score = 26.2 bits (55), Expect = 8.5 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = +3 Query: 90 KNGFVMLKGRPCKIVEMSTSKTGKHGHAKVHLVGID 197 K+G ++L GR C++ + ++ KH + VH ID Sbjct: 837 KDGRILLYGRVCEMERIIRTEKRKHSISLVHESEID 872 >SB_40632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 776 Score = 26.2 bits (55), Expect = 8.5 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = +3 Query: 165 GHAKVHLVGIDIFNGKKYEDICPSTHNMDVPHV 263 G + H + + NGK+Y D+C + + VP V Sbjct: 50 GALRYHEGNLQVCNGKEYVDVC-ANNRASVPEV 81 >SB_38795| Best HMM Match : M (HMM E-Value=2.4e-07) Length = 1447 Score = 26.2 bits (55), Expect = 8.5 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = +1 Query: 31 SRPETPGPQPPSPCN 75 +RP TPG +PP P N Sbjct: 52 TRPTTPGMRPPEPIN 66 >SB_2292| Best HMM Match : Extensin_2 (HMM E-Value=0.033) Length = 867 Score = 23.4 bits (48), Expect(2) = 9.1 Identities = 18/51 (35%), Positives = 22/51 (43%) Frame = +1 Query: 46 PGPQPPSPCNVRPCVKTVSLC*RVVHARLLKCPHPKPESTATLKFTWLGLI 198 P P PPSP RP R + A+L + P P P TL LG + Sbjct: 217 PPPPPPSPSPPRPPPPPPPSPPRPLAAKLPE-PPPIPNMPPTLPPPTLGYL 266 Score = 21.0 bits (42), Expect(2) = 9.1 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = +1 Query: 13 TSKTHTSRPETPGPQPP 63 TS + ++P P P+PP Sbjct: 196 TSPSQITQPPPPPPRPP 212 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,873,786 Number of Sequences: 59808 Number of extensions: 292570 Number of successful extensions: 966 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 853 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 955 length of database: 16,821,457 effective HSP length: 74 effective length of database: 12,395,665 effective search space used: 607387585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -