BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301C02f (506 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_04_0188 - 18883979-18884250,18885046-18885666,18885762-188858... 33 0.17 11_05_0052 + 18683077-18683385 31 0.70 09_01_0093 - 1360596-1360625,1363562-1364266 31 0.70 05_01_0120 - 828834-831143 31 0.70 08_01_0300 + 2427524-2427827,2429066-2429274,2429512-2430150 30 0.93 03_05_0337 - 23272845-23273271,23273318-23273526,23275615-23276298 30 0.93 03_05_0209 + 22014556-22015308 30 1.2 02_04_0530 + 23702714-23703787 30 1.2 07_03_1450 + 26620178-26620456,26622122-26622775 29 1.6 11_02_0037 - 7613632-7613727,7614452-7615507 29 2.1 09_04_0076 + 14350020-14350164,14351020-14351129,14351436-143516... 29 2.1 01_03_0130 + 12853325-12853948,12854657-12854822,12854907-128551... 29 2.1 02_03_0064 + 14607975-14608925 29 2.8 01_06_1291 + 36032088-36032299,36032737-36033314,36034494-36036229 29 2.8 11_06_0610 - 25449085-25453284 28 3.7 10_01_0295 - 3060398-3060415,3060487-3061011 28 3.7 07_03_0094 + 13335281-13335412,13337125-13337208,13337517-13338323 28 3.7 09_04_0296 + 16461482-16461544,16462087-16463097 28 5.0 02_05_0084 - 25690346-25691206 28 5.0 08_02_0885 + 22268287-22268988 27 6.5 08_01_0910 + 8968896-8968932,8969111-8969181,8970417-8970740,897... 27 6.5 07_03_0624 + 20044406-20044756,20045168-20045221 27 6.5 06_03_0867 + 25534760-25539620,25540662-25540857,25540957-255411... 27 6.5 05_07_0100 + 27679280-27680320 27 6.5 02_02_0059 - 6432945-6433115,6433975-6434061,6434585-6434787,643... 27 6.5 02_01_0035 - 220036-221419,222050-222801 27 6.5 07_01_0017 - 114497-114547,114700-114816,114917-114997,115312-11... 27 8.7 03_05_0928 + 28888405-28889121 27 8.7 03_03_0191 + 15302384-15302422,15302780-15303246,15303356-153035... 27 8.7 >05_04_0188 - 18883979-18884250,18885046-18885666,18885762-18885887, 18886007-18886265 Length = 425 Score = 32.7 bits (71), Expect = 0.17 Identities = 16/31 (51%), Positives = 17/31 (54%) Frame = +3 Query: 384 QAPEHSHHQLHDASLPPPANRSSGEYRRSGP 476 QA H HH H A PP +RSS RRS P Sbjct: 3 QASSHQHHYQHSAK--PPVSRSSSWIRRSPP 31 >11_05_0052 + 18683077-18683385 Length = 102 Score = 30.7 bits (66), Expect = 0.70 Identities = 19/48 (39%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = -3 Query: 468 SGDIPPKTCSQAGGGMHRAAGDGSVRALAPVDSCGPDGTRYR--TRFP 331 +G P T + GGG +GDG VRA P +CG +R +RFP Sbjct: 37 TGAADPTTVMRRGGG----SGDGEVRAHPPCTACGCLSHHHRGESRFP 80 >09_01_0093 - 1360596-1360625,1363562-1364266 Length = 244 Score = 30.7 bits (66), Expect = 0.70 Identities = 18/55 (32%), Positives = 26/55 (47%), Gaps = 1/55 (1%) Frame = -3 Query: 477 RVLSGDIPPKTCSQAGGGMHRAAGD-GSVRALAPVDSCGPDGTRYRTRFPKCRSF 316 +V++ D + SQ G G +GD G V+ G DGT R P+C +F Sbjct: 90 KVVAADEVGTSSSQGGKGTADGSGDKGDGLQDGVVEDLGEDGTEVREEPPRCTNF 144 >05_01_0120 - 828834-831143 Length = 769 Score = 30.7 bits (66), Expect = 0.70 Identities = 16/46 (34%), Positives = 20/46 (43%) Frame = -3 Query: 468 SGDIPPKTCSQAGGGMHRAAGDGSVRALAPVDSCGPDGTRYRTRFP 331 S D PP + AG G AG G R + P P G + R+ P Sbjct: 28 SRDTPPDAATPAGAGGGGGAGAGQARRIPPPPPLTPRGGKGRSCLP 73 >08_01_0300 + 2427524-2427827,2429066-2429274,2429512-2430150 Length = 383 Score = 30.3 bits (65), Expect = 0.93 Identities = 13/28 (46%), Positives = 17/28 (60%) Frame = -3 Query: 465 GDIPPKTCSQAGGGMHRAAGDGSVRALA 382 GD PP + GGGM ++A GS+ LA Sbjct: 49 GDKPPTAAAGGGGGMRKSASMGSLAQLA 76 >03_05_0337 - 23272845-23273271,23273318-23273526,23275615-23276298 Length = 439 Score = 30.3 bits (65), Expect = 0.93 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = +3 Query: 354 YRLARSCPQVQAPEHSHHQLHDASL-PPPANRSSGE 458 + A + AP H HH H L PPPA SS + Sbjct: 97 FTAAAAAAAAAAPPHHHHHHHGGPLTPPPATSSSSQ 132 >03_05_0209 + 22014556-22015308 Length = 250 Score = 29.9 bits (64), Expect = 1.2 Identities = 18/64 (28%), Positives = 29/64 (45%) Frame = +1 Query: 220 ATLKLTASTWVNFAVFSETVTTSLTMTSGYLMERSALRKASSVTRTVWPAAVHRCKRPNT 399 A + L + + V + VFS T+ L ++M + AL S+ A +RC + Sbjct: 36 ALISLVSPSSVEYTVFSSTLPAPLRALGSFVMSKKALFVLSNAIFLFLAADYYRCFFSLS 95 Query: 400 PITS 411 P TS Sbjct: 96 PSTS 99 >02_04_0530 + 23702714-23703787 Length = 357 Score = 29.9 bits (64), Expect = 1.2 Identities = 20/46 (43%), Positives = 23/46 (50%), Gaps = 6/46 (13%) Frame = +2 Query: 383 ASARTLPSPAARCIPPPACEQ------VFGGISPLRTLSXFMDMSP 502 A+AR P P A PP A EQ +FGG SPL +D SP Sbjct: 166 AAARK-PPPLALSSPPAAAEQEDDLIDIFGGDSPLPAHEDLLDASP 210 >07_03_1450 + 26620178-26620456,26622122-26622775 Length = 310 Score = 29.5 bits (63), Expect = 1.6 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +3 Query: 375 PQVQAPEHSHHQLHDASLPPP 437 P P H HH L+ SLPPP Sbjct: 133 PMPHQPYHHHHHLNPFSLPPP 153 >11_02_0037 - 7613632-7613727,7614452-7615507 Length = 383 Score = 29.1 bits (62), Expect = 2.1 Identities = 14/49 (28%), Positives = 20/49 (40%), Gaps = 1/49 (2%) Frame = +3 Query: 288 PYDDFRLPNGKICTSESEFGNAYRLARSCPQVQAPE-HSHHQLHDASLP 431 P+ + G + +G AY AR+ P P H HH H +P Sbjct: 223 PHHHHKNGGGLLVAGGDPYGAAYAAARALPPPPPPPPHGHHHHHQIIMP 271 >09_04_0076 + 14350020-14350164,14351020-14351129,14351436-14351601, 14351740-14351840,14351960-14352032,14352111-14352252, 14353239-14353399,14354017-14354129,14354226-14354325, 14354580-14354676,14354798-14354849,14355074-14355175, 14355256-14355402,14355485-14355656,14355752-14355991, 14356565-14356621,14356853-14356942,14357089-14357284, 14358117-14358228,14358305-14358459,14359155-14360580, 14360663-14360857,14361214-14361684 Length = 1540 Score = 29.1 bits (62), Expect = 2.1 Identities = 19/63 (30%), Positives = 34/63 (53%) Frame = -1 Query: 386 LHLWTAAGQTVRVTELAFRSADLSIR*PEVIVRLVVTVSEKTAKFTQVEAVSFNVAHLKF 207 L+ T+ ++RVT RS D+ + P V L V++S+ +FTQ+ ++ + L+F Sbjct: 749 LYQITSRFDSLRVTP---RSLDILAKGPPVCGDLAVSLSQAGPQFTQIMRCNYAIKALRF 805 Query: 206 RCA 198 A Sbjct: 806 STA 808 >01_03_0130 + 12853325-12853948,12854657-12854822,12854907-12855118, 12855372-12855865,12856228-12856276,12856367-12856690 Length = 622 Score = 29.1 bits (62), Expect = 2.1 Identities = 15/52 (28%), Positives = 26/52 (50%) Frame = +3 Query: 318 KICTSESEFGNAYRLARSCPQVQAPEHSHHQLHDASLPPPANRSSGEYRRSG 473 ++ +S + A +A + P H HH LH LP A+ +S + ++SG Sbjct: 17 RLLSSATAAAAAATVATATPLFPRCPHPHHHLHGRRLPFLASAASQQQQQSG 68 >02_03_0064 + 14607975-14608925 Length = 316 Score = 28.7 bits (61), Expect = 2.8 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Frame = -3 Query: 429 GGMHRAAGDGSVRALAPVDSCGPD--GTRYRTRFPKCR 322 G H + GDG AL P GPD G+ TR P+ R Sbjct: 65 GNGHGSGGDGGDLALVPPSGGGPDGAGSESATRRPRGR 102 >01_06_1291 + 36032088-36032299,36032737-36033314,36034494-36036229 Length = 841 Score = 28.7 bits (61), Expect = 2.8 Identities = 12/44 (27%), Positives = 21/44 (47%) Frame = +3 Query: 315 GKICTSESEFGNAYRLARSCPQVQAPEHSHHQLHDASLPPPANR 446 G +C F N++ ++ P++ PEHS + + PP R Sbjct: 102 GGLCVPSRPFQNSHPISIQRPRLAHPEHSRNTFNPNKTTPPRLR 145 >11_06_0610 - 25449085-25453284 Length = 1399 Score = 28.3 bits (60), Expect = 3.7 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +2 Query: 356 PSGPQLSTGASARTLPSPAARCIPPP 433 PS P+ S+ + ++LP PA +PPP Sbjct: 1106 PSVPKASSPPTEKSLPPPATVSLPPP 1131 >10_01_0295 - 3060398-3060415,3060487-3061011 Length = 180 Score = 28.3 bits (60), Expect = 3.7 Identities = 17/56 (30%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Frame = -3 Query: 477 RVLSGDIPPKTCSQAGGGMHRAAGD-GSVRALAPVDSCGPDGTRYRTRFPKCRSFH 313 +V++ D + SQ G + A GD G V+ G DG + P+C +FH Sbjct: 90 KVVAADEVGSSSSQGGKCVVDALGDKGDGLQDGVVEDLGEDGAEVQEEPPRCTNFH 145 >07_03_0094 + 13335281-13335412,13337125-13337208,13337517-13338323 Length = 340 Score = 28.3 bits (60), Expect = 3.7 Identities = 18/53 (33%), Positives = 22/53 (41%), Gaps = 1/53 (1%) Frame = +1 Query: 283 TSLTMTS-GYLMERSALRKASSVTRTVWPAAVHRCKRPNTPITSCTMHPSPRL 438 T L MTS G ++ TVWPAA+ RP P T + P L Sbjct: 80 TLLRMTSSGAAAVNFTFHFHNNCPETVWPAALSSAGRPPFPTTGFALPPGASL 132 >09_04_0296 + 16461482-16461544,16462087-16463097 Length = 357 Score = 27.9 bits (59), Expect = 5.0 Identities = 17/69 (24%), Positives = 28/69 (40%) Frame = +3 Query: 273 DGNNEPYDDFRLPNGKICTSESEFGNAYRLARSCPQVQAPEHSHHQLHDASLPPPANRSS 452 D ++ Y F + +ES +R S P Q PE A+ PP ++ Sbjct: 133 DASSSSYSSFTCSSASTTDTES---TTHRRRHSQPPPQQPEDVDAAAAAAAAAPPNSKPK 189 Query: 453 GEYRRSGPC 479 + ++S PC Sbjct: 190 KKKKKSRPC 198 >02_05_0084 - 25690346-25691206 Length = 286 Score = 27.9 bits (59), Expect = 5.0 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 333 ESEFGNAYRLARSCPQVQAPEHSHHQLHDASLPPPA 440 + + G+ + S P V++P H++H AS P PA Sbjct: 153 DDDGGHRHGSTGSSPPVRSPWHANHHAAAASTPAPA 188 >08_02_0885 + 22268287-22268988 Length = 233 Score = 27.5 bits (58), Expect = 6.5 Identities = 16/46 (34%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +1 Query: 289 LTMTSGYLMERSALRKASSVTR--TVWPAAVHRCKRPNTPITSCTM 420 LTMT +M KA+ + T PA RC+RP+ +C M Sbjct: 31 LTMTHNCVMYLKNKEKAAGSVKGKTAIPATPRRCRRPDGSNPACKM 76 >08_01_0910 + 8968896-8968932,8969111-8969181,8970417-8970740, 8972878-8972934,8974578-8974641,8974749-8974810 Length = 204 Score = 27.5 bits (58), Expect = 6.5 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = +1 Query: 367 AAVHRCKRPNTPITSCTMHPSP 432 A +HRC NTP+ C HP P Sbjct: 4 AQLHRC---NTPVQGCYSHPMP 22 >07_03_0624 + 20044406-20044756,20045168-20045221 Length = 134 Score = 27.5 bits (58), Expect = 6.5 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = -3 Query: 438 QAGGGMHRAAGDGSVRALAPVDSCGPDGTRYRTRFP 331 +AGGG R A DG R++A D G R R+ P Sbjct: 27 EAGGGRRRGADDGGGRSVAEEDG----GQRRRSHLP 58 >06_03_0867 + 25534760-25539620,25540662-25540857,25540957-25541104, 25541673-25541751,25542151-25542238,25542330-25542600, 25542676-25542718,25542801-25542904,25543374-25543790 Length = 2068 Score = 27.5 bits (58), Expect = 6.5 Identities = 11/21 (52%), Positives = 12/21 (57%) Frame = +3 Query: 375 PQVQAPEHSHHQLHDASLPPP 437 P+VQ H HHQ A PPP Sbjct: 73 PRVQHHHHHHHQQLPAPTPPP 93 >05_07_0100 + 27679280-27680320 Length = 346 Score = 27.5 bits (58), Expect = 6.5 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +2 Query: 362 GPQLSTGASARTLPSPAARCIPPP 433 GP LS AS R PSP+ +PPP Sbjct: 130 GPTLSASASKRPSPSPSP--VPPP 151 >02_02_0059 - 6432945-6433115,6433975-6434061,6434585-6434787, 6435281-6435392,6435473-6435517,6435622-6435726, 6435946-6435996,6436026-6436103,6437258-6437313, 6437784-6437853,6438288-6438392,6438525-6438637, 6439354-6439534,6439635-6440390 Length = 710 Score = 27.5 bits (58), Expect = 6.5 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 375 PQVQAPEHSHHQLHDASLPPPANRSSGEYRRSGP 476 P A S H LH A L P ANR +G P Sbjct: 221 PAATARPPSSHTLHQAHLMPNANRYNGPIHNEVP 254 >02_01_0035 - 220036-221419,222050-222801 Length = 711 Score = 27.5 bits (58), Expect = 6.5 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = +3 Query: 393 EHSHHQLHDASLPPPANRSSGEYRRSGPCH 482 E HHQ H PPPA + + P H Sbjct: 113 EQHHHQKHQQQPPPPARWAPQHHHHHHPHH 142 >07_01_0017 - 114497-114547,114700-114816,114917-114997,115312-115371, 116029-116238,116412-116720,116790-117080 Length = 372 Score = 27.1 bits (57), Expect = 8.7 Identities = 9/32 (28%), Positives = 19/32 (59%) Frame = +3 Query: 117 IIEKDVFAFRQPSNRIGVGSLYGLMVFCTSKL 212 ++ +F QP +R+ + L+G++V C S + Sbjct: 227 LVPSHIFQVNQPMHRLPLHVLHGIIVLCVSAI 258 >03_05_0928 + 28888405-28889121 Length = 238 Score = 27.1 bits (57), Expect = 8.7 Identities = 18/45 (40%), Positives = 21/45 (46%), Gaps = 4/45 (8%) Frame = -3 Query: 459 IPPKTCSQAGGG----MHRAAGDGSVRALAPVDSCGPDGTRYRTR 337 + P + GGG MH AA G+V VD G G R RTR Sbjct: 79 VAPMLPAPGGGGPPGYMHMAAMGGAVGGGGGVDGGGGSGGRRRTR 123 >03_03_0191 + 15302384-15302422,15302780-15303246,15303356-15303563, 15303723-15303794,15304295-15304430,15304619-15304890, 15305197-15305345,15305818-15305947,15306244-15306258 Length = 495 Score = 27.1 bits (57), Expect = 8.7 Identities = 19/69 (27%), Positives = 34/69 (49%), Gaps = 1/69 (1%) Frame = -1 Query: 227 NVAHLKFRCAEDHETVQ*ANTDSVAWLTESEHILFDDRESFGSSVQNSLSIFFQFDDSSA 48 +V +L RC + Q NTD ++W+ S+ ++ + ++S S + DD SA Sbjct: 163 DVDNLFRRCDSTYGQQQLPNTDELSWIPSSD-AMYSSDVAMQPGFESSYSDYGILDDLSA 221 Query: 47 L-IFQNKSL 24 ++KSL Sbjct: 222 FNCTEDKSL 230 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,723,236 Number of Sequences: 37544 Number of extensions: 364195 Number of successful extensions: 1700 Number of sequences better than 10.0: 29 Number of HSP's better than 10.0 without gapping: 1604 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1691 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1083123860 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -