BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301C01f (447 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC16G5.14c |rps3||40S ribosomal protein S3|Schizosaccharomyces... 161 6e-41 SPAPB1E7.07 |glt1||glutamate synthase Glt1 |Schizosaccharomyces ... 28 0.57 SPAC3H5.09c |||conserved fungal protein|Schizosaccharomyces pomb... 26 3.0 SPBPB2B2.12c |||UDP-glucose 4-epimerase|Schizosaccharomyces pomb... 25 5.3 SPBC1711.17 |prp16|SPBC17G9.01|ATP-dependent RNA helicase Prp16|... 25 7.0 SPBC336.11 |||GARP complex subunit Vps52 |Schizosaccharomyces po... 25 7.0 SPAC607.09c |btn1||battenin CLN3 family protein|Schizosaccharomy... 24 9.3 SPCC970.07c |raf2|dos2, cmc2, clr7|Rik1-associated factor Raf2|S... 24 9.3 >SPBC16G5.14c |rps3||40S ribosomal protein S3|Schizosaccharomyces pombe|chr 2|||Manual Length = 249 Score = 161 bits (390), Expect = 6e-41 Identities = 77/119 (64%), Positives = 93/119 (78%) Frame = -2 Query: 446 SXRYKLIGGLAVRRACYGVLRFIMEXGARGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDP 267 S RYKL+ GLAVRRA YGVLR++ME GA+GCEVV+SGKLR RAKSMKF DG MIHSG P Sbjct: 106 SLRYKLLAGLAVRRAAYGVLRYVMEAGAKGCEVVISGKLRAARAKSMKFADGFMIHSGQP 165 Query: 266 CNDYVNTATRHVLLRQGVLGIKVKIMLPWDQQGKNGPKKPQPDHILVTEPKDEPVPLEP 90 D++++ATRHVLLRQGVLG+KVKIMLP + K KK PD ++V +PK+E +P Sbjct: 166 AVDFIDSATRHVLLRQGVLGVKVKIMLP---EPKTRQKKSLPDIVVVLDPKEEEPITKP 221 >SPAPB1E7.07 |glt1||glutamate synthase Glt1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2111 Score = 28.3 bits (60), Expect = 0.57 Identities = 15/52 (28%), Positives = 26/52 (50%) Frame = -2 Query: 389 LRFIMEXGARGCEVVVSGKLRGQRAKSMKFVDGLMIHSGDPCNDYVNTATRH 234 + F ME + + ++ +L+ S K D ++I GD ND + T+ RH Sbjct: 1868 IHFAMEFLHKNTKSLLDSELKDGNYISAKGKDVIVIGGGDTGNDCLGTSVRH 1919 >SPAC3H5.09c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 2685 Score = 25.8 bits (54), Expect = 3.0 Identities = 9/31 (29%), Positives = 16/31 (51%), Gaps = 1/31 (3%) Frame = -1 Query: 324 STCQINEVCR-WTHDPLWRPLQ*LRQHCYQT 235 + C + CR W P W+ + + Q+C+ T Sbjct: 1420 TVCNRKKACRLWNFKPHWQVITRIPQYCHDT 1450 >SPBPB2B2.12c |||UDP-glucose 4-epimerase|Schizosaccharomyces pombe|chr 2|||Manual Length = 713 Score = 25.0 bits (52), Expect = 5.3 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -2 Query: 326 GQRAKSMKFVDGLMIHSGDPCNDYVN 249 G+R K + F D H G P DY++ Sbjct: 218 GRREKLLVFGDDYDSHDGTPIRDYIH 243 >SPBC1711.17 |prp16|SPBC17G9.01|ATP-dependent RNA helicase Prp16|Schizosaccharomyces pombe|chr 2|||Manual Length = 1173 Score = 24.6 bits (51), Expect = 7.0 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -2 Query: 269 PCNDYVNTATRHVL 228 PC+DYV A R VL Sbjct: 679 PCSDYVEAAVRQVL 692 >SPBC336.11 |||GARP complex subunit Vps52 |Schizosaccharomyces pombe|chr 2|||Manual Length = 508 Score = 24.6 bits (51), Expect = 7.0 Identities = 8/11 (72%), Positives = 10/11 (90%) Frame = -1 Query: 162 RPEEATTRPHP 130 +PEE T+RPHP Sbjct: 404 KPEEITSRPHP 414 >SPAC607.09c |btn1||battenin CLN3 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 396 Score = 24.2 bits (50), Expect = 9.3 Identities = 12/42 (28%), Positives = 19/42 (45%) Frame = +1 Query: 109 SSLGSVTRMWSGCGFFGPFLPCWSHGNMILTLIPSTPCLRST 234 SS G ++ + + LPCWS G + L ++ L T Sbjct: 110 SSFGEISFLHLSSRYHSVSLPCWSSGTGLAGLFGASSYLVMT 151 >SPCC970.07c |raf2|dos2, cmc2, clr7|Rik1-associated factor Raf2|Schizosaccharomyces pombe|chr 3|||Manual Length = 636 Score = 24.2 bits (50), Expect = 9.3 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = -2 Query: 215 VLGIKVKIMLPWDQQGKNGPKKPQPDHILVTEPKDEPVPLEPTSEVRS 72 VLG +KI W K+ P+K + I + P+ L P+SE ++ Sbjct: 61 VLGYSIKISPVWTYNLKDVPEK-ETMSIWIVTPQRRYGILSPSSEYKA 107 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,633,312 Number of Sequences: 5004 Number of extensions: 31579 Number of successful extensions: 81 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 81 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 81 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 164204010 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -