BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301B09f (406 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_2144| Best HMM Match : MACPF (HMM E-Value=0.007) 31 0.47 SB_17753| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.3 >SB_2144| Best HMM Match : MACPF (HMM E-Value=0.007) Length = 434 Score = 30.7 bits (66), Expect = 0.47 Identities = 23/85 (27%), Positives = 44/85 (51%), Gaps = 4/85 (4%) Frame = -2 Query: 351 CRHFLFIYLISFVR---NLRS*VLIVYFPLCPRTNKSMVYFL-IIANYS*RNSLVFVTDL 184 CR +L +Y I R N + +++ F C R ++ + II N +V T + Sbjct: 151 CRQYLSVYDIDVSRIYVNYHNHFIMLGF--CYRCLSIIIIIVTIIIIIIIVNVIVIFTII 208 Query: 183 AVVVFIILLSVVTIYLRNDVTFVLF 109 +++F ++++V+ IYL+ F+LF Sbjct: 209 IIIIFTVIVNVIAIYLQAFNYFLLF 233 >SB_17753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 243 Score = 27.9 bits (59), Expect = 3.3 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -1 Query: 202 SIRYRSCCCCIHNIIVCG 149 +I +CCCCI N I+ G Sbjct: 94 NINNNNCCCCIRNNIIMG 111 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,772,691 Number of Sequences: 59808 Number of extensions: 172978 Number of successful extensions: 332 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 289 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 328 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 727815563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -