BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301B08f (403 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 23 1.5 AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain tran... 21 6.0 AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. 21 6.0 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 22.6 bits (46), Expect = 1.5 Identities = 11/32 (34%), Positives = 20/32 (62%), Gaps = 1/32 (3%) Frame = -2 Query: 300 LGRLKEQQVRP-HMELKPTLEPQGLLHKELEL 208 +GR +Q V+ +++ L+ QGLLH++ L Sbjct: 609 IGRSPDQNVKKINLKHALDLDRQGLLHRQFNL 640 >AF452568-1|AAL57830.1| 243|Tribolium castaneum homeodomain transcription factor Zen2 protein. Length = 243 Score = 20.6 bits (41), Expect = 6.0 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +2 Query: 287 FSRPSVSFLRQIRFFPLHLLNKFADN 364 +SRP+ S+LR +F P ++N Sbjct: 44 YSRPNWSYLRTPQFEPQQFEVSLSEN 69 >AF321227-5|AAK16425.1| 292|Tribolium castaneum Zen2 protein. Length = 292 Score = 20.6 bits (41), Expect = 6.0 Identities = 9/26 (34%), Positives = 15/26 (57%) Frame = +2 Query: 287 FSRPSVSFLRQIRFFPLHLLNKFADN 364 +SRP+ S+LR +F P ++N Sbjct: 64 YSRPNWSYLRTPQFEPQQFEVSLSEN 89 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 62,034 Number of Sequences: 336 Number of extensions: 920 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 8646818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -