BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301B05f (356 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex det... 23 0.82 DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex det... 23 0.82 DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex det... 23 0.82 DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex det... 23 0.82 DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex det... 23 0.82 DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex det... 23 0.82 DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex det... 23 0.82 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 23 0.82 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 23 0.82 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 23 0.82 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 23 0.82 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 23 0.82 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 23 0.82 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 23 0.82 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 23 0.82 DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex det... 23 1.1 DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex det... 23 1.1 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 23 1.4 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 23 1.4 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 23 1.4 DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex det... 23 1.4 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 23 1.4 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 23 1.4 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 23 1.4 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 23 1.4 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 23 1.4 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 23 1.4 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 23 1.4 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 23 1.4 DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex det... 23 1.4 DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex det... 23 1.4 DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex det... 23 1.4 DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex det... 23 1.4 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 23 1.4 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 23 1.4 DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex det... 22 1.9 DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex det... 22 1.9 DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex det... 22 1.9 DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex det... 22 1.9 DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex det... 22 1.9 DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex det... 22 1.9 DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex det... 22 1.9 DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex det... 22 1.9 DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex det... 22 1.9 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 22 1.9 AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phospha... 22 1.9 DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex det... 22 2.5 DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex det... 22 2.5 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 22 2.5 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 22 2.5 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 22 2.5 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 22 2.5 AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced prot... 22 2.5 DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex det... 21 3.3 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 4.4 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 21 5.8 DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex det... 21 5.8 DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 21 5.8 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 21 5.8 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 21 5.8 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 21 5.8 DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex det... 21 5.8 DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex det... 21 5.8 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 21 5.8 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 21 5.8 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 21 5.8 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 21 5.8 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 21 5.8 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 21 5.8 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 21 5.8 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 21 5.8 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 21 5.8 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 21 5.8 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 5.8 >DQ325067-1|ABD14081.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.4 bits (48), Expect = 0.82 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -2 Query: 169 HIR-RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 H+R RT R SR+R SY N R Y + + +R+ Sbjct: 29 HLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERS 67 >DQ325066-1|ABD14080.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.4 bits (48), Expect = 0.82 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -2 Query: 169 HIR-RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 H+R RT R SR+R SY N R Y + + +R+ Sbjct: 29 HLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERS 67 >DQ325065-1|ABD14079.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.4 bits (48), Expect = 0.82 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -2 Query: 169 HIR-RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 H+R RT R SR+R SY N R Y + + +R+ Sbjct: 29 HLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERS 67 >DQ325064-1|ABD14078.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.4 bits (48), Expect = 0.82 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -2 Query: 169 HIR-RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 H+R RT R SR+R SY N R Y + + +R+ Sbjct: 29 HLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERS 67 >DQ325063-1|ABD14077.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.4 bits (48), Expect = 0.82 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -2 Query: 169 HIR-RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 H+R RT R SR+R SY N R Y + + +R+ Sbjct: 29 HLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERS 67 >DQ325062-1|ABD14076.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.4 bits (48), Expect = 0.82 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -2 Query: 169 HIR-RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 H+R RT R SR+R SY N R Y + + +R+ Sbjct: 29 HLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERS 67 >DQ325061-1|ABD14075.1| 152|Apis mellifera complementary sex determiner protein. Length = 152 Score = 23.4 bits (48), Expect = 0.82 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -2 Query: 169 HIR-RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 H+R RT R SR+R SY N R Y + + +R+ Sbjct: 29 HLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERS 67 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.4 bits (48), Expect = 0.82 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -2 Query: 169 HIR-RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 H+R RT R SR+R SY N R Y + + +R+ Sbjct: 278 HLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERS 316 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.4 bits (48), Expect = 0.82 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -2 Query: 169 HIR-RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 H+R RT R SR+R SY N R Y + + +R+ Sbjct: 278 HLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERS 316 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.4 bits (48), Expect = 0.82 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -2 Query: 169 HIR-RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 H+R RT R SR+R SY N R Y + + +R+ Sbjct: 278 HLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERS 316 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.4 bits (48), Expect = 0.82 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -2 Query: 169 HIR-RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 H+R RT R SR+R SY N R Y + + +R+ Sbjct: 278 HLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERS 316 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.4 bits (48), Expect = 0.82 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -2 Query: 169 HIR-RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 H+R RT R SR+R SY N R Y + + +R+ Sbjct: 278 HLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERS 316 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 23.4 bits (48), Expect = 0.82 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -2 Query: 169 HIR-RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 H+R RT R SR+R SY N R Y + + +R+ Sbjct: 278 HLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERS 316 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 23.4 bits (48), Expect = 0.82 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -2 Query: 169 HIR-RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 H+R RT R SR+R SY N R Y + + +R+ Sbjct: 277 HLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERS 315 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 23.4 bits (48), Expect = 0.82 Identities = 14/39 (35%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -2 Query: 169 HIR-RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 H+R RT R SR+R SY N R Y + + +R+ Sbjct: 278 HLRERTSRRRYSRSREREQKSYKNEREYREYRETSRERS 316 >DQ325089-1|ABD14103.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.0 bits (47), Expect = 1.1 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 RT R SR+R +SY N R Y + + +R+ Sbjct: 32 RTNRKRNSRSREREQNSYKNEREYRKYRETSKERS 66 >DQ325088-1|ABD14102.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.0 bits (47), Expect = 1.1 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 RT R SR+R +SY N R Y + + +R+ Sbjct: 32 RTNRKRNSRSREREQNSYKNEREYRKYRETSKERS 66 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.6 bits (46), Expect = 1.4 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 RT R SR+R +SY N R Y + + +R+ Sbjct: 33 RTSRKRYSRSREREQNSYKNEREYRKYRETSKERS 67 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.6 bits (46), Expect = 1.4 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 RT R SR+R +SY N R Y + + +R+ Sbjct: 33 RTSRKRYSRSREREQNSYKNEREYRKYRETSKERS 67 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.6 bits (46), Expect = 1.4 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 RT R SR+R +SY N R Y + + +R+ Sbjct: 33 RTSRKRYSRSREREQNSYKNEREYRKYRETSKERS 67 >DQ325103-1|ABD14117.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 22.6 bits (46), Expect = 1.4 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 RT R SR+R +SY N R Y + + +R+ Sbjct: 33 RTSRKRYSRSREREQNSYKNEREYRKYRETSKERS 67 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.6 bits (46), Expect = 1.4 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 RT R SR+R +SY N R Y + + +R+ Sbjct: 33 RTSRKRYSRSREREQNSYKNEREYRKYRETSKERS 67 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 22.6 bits (46), Expect = 1.4 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 RT R SR+R +SY N R Y + + +R+ Sbjct: 33 RTSRKRYSRSREREQNSYKNEREYRKYRETSKERS 67 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.6 bits (46), Expect = 1.4 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 RT R SR+R +SY N R Y + + +R+ Sbjct: 33 RTSRKRYSRSREREQNSYKNEREYRKYRETSKERS 67 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.6 bits (46), Expect = 1.4 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 RT R SR+R +SY N R Y + + +R+ Sbjct: 33 RTSRKRYSRSREREQNSYKNEREYRKYRETSKERS 67 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.6 bits (46), Expect = 1.4 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 RT R SR+R +SY N R Y + + +R+ Sbjct: 33 RTSRKRYSRSREREQNSYKNEREYRKYRETSKERS 67 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.6 bits (46), Expect = 1.4 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 RT R SR+R +SY N R Y + + +R+ Sbjct: 33 RTSRKRYSRSREREQNSYKNEREYRKYRETSKERS 67 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.6 bits (46), Expect = 1.4 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 RT R SR+R +SY N R Y + + +R+ Sbjct: 33 RTSRKRYSRSREREQNSYKNEREYRKYRETSKERS 67 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.6 bits (46), Expect = 1.4 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 RT R SR+R +SY N R Y + + +R+ Sbjct: 33 RTSRKRYSRSREREQNSYKNEREYRKYRETSKERS 67 >DQ325087-1|ABD14101.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.6 bits (46), Expect = 1.4 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 RT R SR+R +SY N R Y + + +R+ Sbjct: 33 RTSRKRYSRSREREQNSYKNEREYRKYRETSKERS 67 >DQ325086-1|ABD14100.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.6 bits (46), Expect = 1.4 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 RT R SR+R +SY N R Y + + +R+ Sbjct: 33 RTSRKRYSRSREREQNSYKNEREYRKYRETSKERS 67 >DQ325085-1|ABD14099.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.6 bits (46), Expect = 1.4 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 RT R SR+R +SY N R Y + + +R+ Sbjct: 33 RTSRKRYSRSREREQNSYKNEREYRKYRETSKERS 67 >DQ325084-1|ABD14098.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 22.6 bits (46), Expect = 1.4 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 RT R SR+R +SY N R Y + + +R+ Sbjct: 33 RTSRKRYSRSREREQNSYKNEREYRKYRETSKERS 67 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.6 bits (46), Expect = 1.4 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 RT R SR+R +SY N R Y + + +R+ Sbjct: 255 RTSRKRYSRSREREQNSYKNEREYRKYRETSKERS 289 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 22.6 bits (46), Expect = 1.4 Identities = 12/35 (34%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 RT R SR+R SY N R Y + + +R+ Sbjct: 266 RTSRERYSRSREREQKSYKNEREYRKYGETSKERS 300 >DQ325132-1|ABD14146.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 22.2 bits (45), Expect = 1.9 Identities = 12/35 (34%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 RT R SR+R SY N R Y + + +R+ Sbjct: 33 RTSRKRYSRSREREQKSYKNEREYRKYRETSKERS 67 >DQ325131-1|ABD14145.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 22.2 bits (45), Expect = 1.9 Identities = 12/35 (34%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 RT R SR+R SY N R Y + + +R+ Sbjct: 33 RTSRKRYSRSREREQKSYKNEREYRKYRETSKERS 67 >DQ325121-1|ABD14135.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 1.9 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 RT R SR+R +SY N R Y + + +R+ Sbjct: 33 RTSRNRYSRSREREQNSYKNEREYQKYRETSKERS 67 >DQ325120-1|ABD14134.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 1.9 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 RT R SR+R +SY N R Y + + +R+ Sbjct: 33 RTSRNRYSRSREREQNSYKNEREYQKYRETSKERS 67 >DQ325119-1|ABD14133.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 1.9 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 RT R SR+R +SY N R Y + + +R+ Sbjct: 33 RTSRNRYSRSREREQNSYKNEREYQKYRETSKERS 67 >DQ325118-1|ABD14132.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 1.9 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 RT R SR+R +SY N R Y + + +R+ Sbjct: 33 RTSRNRYSRSREREQNSYKNEREYQKYRETSKERS 67 >DQ325117-1|ABD14131.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 1.9 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 RT R SR+R +SY N R Y + + +R+ Sbjct: 33 RTSRNRYSRSREREQNSYKNEREYQKYRETSKERS 67 >DQ325116-1|ABD14130.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 1.9 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 RT R SR+R +SY N R Y + + +R+ Sbjct: 33 RTSRNRYSRSREREQNSYKNEREYQKYRETSKERS 67 >DQ325114-1|ABD14128.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 22.2 bits (45), Expect = 1.9 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 RT R SR+R +SY N R Y + + +R+ Sbjct: 33 RTSRNRYSRSREREQNSYKNEREYQKYRETSKERS 67 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.2 bits (45), Expect = 1.9 Identities = 12/35 (34%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 RT R SR+R SY N R Y + + +R+ Sbjct: 255 RTSRKRYSRSREREQKSYKNEREYRKYGKTSKERS 289 >AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phosphate dehydrogenase protein. Length = 363 Score = 22.2 bits (45), Expect = 1.9 Identities = 7/23 (30%), Positives = 14/23 (60%) Frame = -3 Query: 135 KVVNGRSLLTQIEDTDLGIRYTP 67 +++NG+ L I +T ++Y P Sbjct: 44 EIINGKKLTEIINETHENVKYLP 66 >DQ325077-1|ABD14091.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.8 bits (44), Expect = 2.5 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 RT R SR+R SY N R+Y + + +R+ Sbjct: 33 RTSRKRYSRSREREQKSYKNERKYRKYRERSKERS 67 >DQ325076-1|ABD14090.1| 191|Apis mellifera complementary sex determiner protein. Length = 191 Score = 21.8 bits (44), Expect = 2.5 Identities = 12/35 (34%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 RT R SR+R SY N R+Y + + +R+ Sbjct: 33 RTSRKRYSRSREREQKSYKNERKYRKYRERSKERS 67 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.8 bits (44), Expect = 2.5 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPNRR 95 RT R SR+R +SY N R Sbjct: 255 RTSRKRYSRSREREQNSYKNER 276 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.8 bits (44), Expect = 2.5 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPNRR 95 RT R SR+R +SY N R Sbjct: 266 RTSRKRYSRSREREQNSYKNER 287 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.8 bits (44), Expect = 2.5 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPNRR 95 RT R SR+R +SY N R Sbjct: 266 RTSRKRYSRSREREQNSYKNER 287 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.8 bits (44), Expect = 2.5 Identities = 12/34 (35%), Positives = 16/34 (47%), Gaps = 1/34 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDR 62 RT R SR+R SY N R Y + + +R Sbjct: 266 RTSHKRYSRSREREQKSYKNEREYRKYRETSKER 299 >AB264313-1|BAF43600.1| 900|Apis mellifera ecdysone-induced protein 75 protein. Length = 900 Score = 21.8 bits (44), Expect = 2.5 Identities = 13/35 (37%), Positives = 17/35 (48%) Frame = -1 Query: 221 YLLQQIRPASKASELSCSYSSDTKCTHSGKSSTVA 117 YL+ PAS LS + +S T + SST A Sbjct: 816 YLMVGNSPASSPRYLSAAATSSTSTSPRPASSTAA 850 >DQ325083-1|ABD14097.1| 189|Apis mellifera complementary sex determiner protein. Length = 189 Score = 21.4 bits (43), Expect = 3.3 Identities = 11/35 (31%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 RT R SR+R +SY N + Y + + +R+ Sbjct: 33 RTSRKRYSRSREREQNSYKNEKEYRKYRETSKERS 67 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.0 bits (42), Expect = 4.4 Identities = 13/40 (32%), Positives = 17/40 (42%), Gaps = 4/40 (10%) Frame = -2 Query: 169 HIRRTPSARTVESRQRSLSSYPNRRY----GSWDQVHPDR 62 HIRRT + + SYP R G D + PD+ Sbjct: 159 HIRRTLHMNRTSLKTSKIVSYPKSRSRKKGGLKDNLIPDK 198 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.6 bits (41), Expect = 5.8 Identities = 11/35 (31%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPNRR-YGSWDQVHPDRT 59 RT R SR+R Y N+R Y + + +R+ Sbjct: 33 RTSRKRYSRSREREQKLYKNKREYRKYRETSKERS 67 >DQ325115-1|ABD14129.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 20.6 bits (41), Expect = 5.8 Identities = 11/35 (31%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPNRR-YGSWDQVHPDRT 59 RT R SR+R Y N+R Y + + +R+ Sbjct: 33 RTSRKRYSRSREREQKLYKNKREYRKYRETSKERS 67 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 20.6 bits (41), Expect = 5.8 Identities = 11/35 (31%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 +T R SR+R SY N R Y + + +R+ Sbjct: 33 KTSRKRYSRSREREQKSYKNEREYREYRETSRERS 67 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 20.6 bits (41), Expect = 5.8 Identities = 11/35 (31%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 +T R SR+R SY N R Y + + +R+ Sbjct: 33 KTSRKRYSRSREREQKSYKNEREYREYRETSRERS 67 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 20.6 bits (41), Expect = 5.8 Identities = 11/35 (31%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 +T R SR+R SY N R Y + + +R+ Sbjct: 33 KTSRKRYSRSREREQKSYKNEREYREYRETSRERS 67 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 20.6 bits (41), Expect = 5.8 Identities = 11/35 (31%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPN-RRYGSWDQVHPDRT 59 +T R SR+R SY N R Y + + +R+ Sbjct: 33 KTSRKRYSRSREREQKSYKNEREYREYRETSRERS 67 >DQ325105-1|ABD14119.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 20.6 bits (41), Expect = 5.8 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPNRR 95 RT R SR+R +SY N + Sbjct: 33 RTSRKRYSRSREREQNSYKNEK 54 >DQ325104-1|ABD14118.1| 180|Apis mellifera complementary sex determiner protein. Length = 180 Score = 20.6 bits (41), Expect = 5.8 Identities = 9/22 (40%), Positives = 12/22 (54%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPNRR 95 RT R SR+R +SY N + Sbjct: 33 RTSRKRYSRSREREQNSYKNEK 54 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.6 bits (41), Expect = 5.8 Identities = 11/35 (31%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPNRR-YGSWDQVHPDRT 59 RT R SR+R Y N+R Y + + +R+ Sbjct: 33 RTSRKRYSRSREREQKLYKNKREYRKYRETSKERS 67 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.6 bits (41), Expect = 5.8 Identities = 11/35 (31%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPNRR-YGSWDQVHPDRT 59 RT R SR+R Y N+R Y + + +R+ Sbjct: 33 RTSRKRYSRSREREQKLYKNKREYRKYRETSKERS 67 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.6 bits (41), Expect = 5.8 Identities = 11/35 (31%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPNRR-YGSWDQVHPDRT 59 RT R SR+R Y N+R Y + + +R+ Sbjct: 33 RTSRKRYSRSREREQKLYKNKREYRKYRETSKERS 67 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.6 bits (41), Expect = 5.8 Identities = 11/35 (31%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPNRR-YGSWDQVHPDRT 59 RT R SR+R Y N+R Y + + +R+ Sbjct: 33 RTSRKRYSRSREREQKLYKNKREYRKYRETSKERS 67 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.6 bits (41), Expect = 5.8 Identities = 11/35 (31%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPNRR-YGSWDQVHPDRT 59 RT R SR+R Y N+R Y + + +R+ Sbjct: 33 RTSRKRYSRSREREQKLYKNKREYRKYRETSKERS 67 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.6 bits (41), Expect = 5.8 Identities = 11/35 (31%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPNRR-YGSWDQVHPDRT 59 RT R SR+R Y N+R Y + + +R+ Sbjct: 33 RTSRKRYSRSREREQKLYKNKREYRKYRETSKERS 67 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.6 bits (41), Expect = 5.8 Identities = 11/35 (31%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPNRR-YGSWDQVHPDRT 59 RT R SR+R Y N+R Y + + +R+ Sbjct: 33 RTSRKRYSRSREREQKLYKNKREYRKYRETSKERS 67 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 20.6 bits (41), Expect = 5.8 Identities = 11/35 (31%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPNRR-YGSWDQVHPDRT 59 RT R SR+R Y N+R Y + + +R+ Sbjct: 33 RTSRKRYSRSREREQKLYKNKREYRKYRETSKERS 67 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 20.6 bits (41), Expect = 5.8 Identities = 11/35 (31%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPNRR-YGSWDQVHPDRT 59 RT R SR+R Y N+R Y + + +R+ Sbjct: 266 RTSRKRYSRSREREQKLYKNKREYRKYRETSKERS 300 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 20.6 bits (41), Expect = 5.8 Identities = 11/35 (31%), Positives = 17/35 (48%), Gaps = 1/35 (2%) Frame = -2 Query: 160 RTPSARTVESRQRSLSSYPNRR-YGSWDQVHPDRT 59 RT R SR+R Y N+R Y + + +R+ Sbjct: 266 RTSRKRYSRSREREQKLYKNKREYRKYRETSKERS 300 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 20.6 bits (41), Expect = 5.8 Identities = 10/28 (35%), Positives = 14/28 (50%) Frame = -3 Query: 222 VLIAADTSCLQSL*AQLFIFVGHQVHAQ 139 VL A +T Q +L +GH H+Q Sbjct: 472 VLFATETGTSQMYAEKLSELLGHAFHSQ 499 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 113,495 Number of Sequences: 438 Number of extensions: 2931 Number of successful extensions: 74 Number of sequences better than 10.0: 74 Number of HSP's better than 10.0 without gapping: 74 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 74 length of database: 146,343 effective HSP length: 51 effective length of database: 124,005 effective search space used: 8308335 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -