BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301A12f (516 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain tran... 21 6.5 AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein p... 21 6.5 AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein p... 21 6.5 AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory recept... 21 8.6 >AY043293-2|AAK96034.1| 353|Tribolium castaneum homeodomain transcription factor Labialprotein. Length = 353 Score = 21.0 bits (42), Expect = 6.5 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = -1 Query: 435 PITSVPTGYSVFLLSITLAICPPIISQGYTLP 340 PI + TG S L + PPI Q Y P Sbjct: 75 PIINTETGLSYTNLDYGNSNFPPINHQNYNEP 106 >AF230313-1|AAF64147.1| 210|Tribolium castaneum labial protein protein. Length = 210 Score = 21.0 bits (42), Expect = 6.5 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = -1 Query: 435 PITSVPTGYSVFLLSITLAICPPIISQGYTLP 340 PI + TG S L + PPI Q Y P Sbjct: 75 PIINTETGLSYTNLDYGNSNFPPINHQNYNEP 106 >AF230312-1|AAF64146.1| 253|Tribolium castaneum labial protein protein. Length = 253 Score = 21.0 bits (42), Expect = 6.5 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = -1 Query: 435 PITSVPTGYSVFLLSITLAICPPIISQGYTLP 340 PI + TG S L + PPI Q Y P Sbjct: 75 PIINTETGLSYTNLDYGNSNFPPINHQNYNEP 106 >AM292364-1|CAL23176.2| 353|Tribolium castaneum gustatory receptor candidate 43 protein. Length = 353 Score = 20.6 bits (41), Expect = 8.6 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -3 Query: 223 TNKWVYYYYFFRYNHI 176 T ++ YYYY F H+ Sbjct: 110 TKRYCYYYYAFFGVHL 125 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 123,335 Number of Sequences: 336 Number of extensions: 2640 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12363686 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -