Bombyx BLAST Result against fruitfly

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ovS301A12f
         (516 letters)

Database: fruitfly 
           53,049 sequences; 24,988,368 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AE014298-1399|AAF46544.1| 4498|Drosophila melanogaster CG2989-PA...    32   0.53 

>AE014298-1399|AAF46544.1| 4498|Drosophila melanogaster CG2989-PA
            protein.
          Length = 4498

 Score = 31.9 bits (69), Expect = 0.53
 Identities = 11/30 (36%), Positives = 19/30 (63%)
 Frame = +2

Query: 404  TEYPVGTLVMGHFGWRTHTITKPENESSVN 493
            T  P+G ++MG FG  T + T  +N++ +N
Sbjct: 4292 TAMPIGAVIMGQFGLNTQSTTAVDNDNQLN 4321


  Database: fruitfly
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 24,988,368
  Number of sequences in database:  53,049
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 21,289,182
Number of Sequences: 53049
Number of extensions: 392123
Number of successful extensions: 798
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 785
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 798
length of database: 24,988,368
effective HSP length: 80
effective length of database: 20,744,448
effective search space used: 1887744768
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)