BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301A12f (516 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 26 0.26 DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 21 7.5 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 21 7.5 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 21 7.5 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 21 7.5 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 21 7.5 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 21 7.5 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 21 7.5 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 21 7.5 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 21 7.5 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 21 7.5 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 21 10.0 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 21 10.0 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 25.8 bits (54), Expect = 0.26 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = -1 Query: 498 VLLTELSFSGLVIVCVLQPK*PITSVPTGYSVFLLSIT 385 V++ F G +I C++ + P PT Y +F L+++ Sbjct: 41 VVIFVTGFVGNIITCIVIWRNPSMQTPTNYYLFNLAVS 78 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.0 bits (42), Expect = 7.5 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = +1 Query: 151 QITETFCRKYGYSEKNNSSKPI 216 +I + Y Y+ NN+ KP+ Sbjct: 80 KIISSLSNNYNYNNYNNNYKPL 101 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.0 bits (42), Expect = 7.5 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = +1 Query: 151 QITETFCRKYGYSEKNNSSKPI 216 +I + Y Y+ NN+ KP+ Sbjct: 80 KIISSLSNNYNYNNYNNNYKPL 101 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.0 bits (42), Expect = 7.5 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = +1 Query: 151 QITETFCRKYGYSEKNNSSKPI 216 +I + Y Y+ NN+ KP+ Sbjct: 80 KIISSLSNNYNYNNYNNNYKPL 101 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 21.0 bits (42), Expect = 7.5 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = +1 Query: 151 QITETFCRKYGYSEKNNSSKPI 216 +I + Y Y+ NN+ KP+ Sbjct: 80 KIISSLSNNYNYNNYNNNYKPL 101 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.0 bits (42), Expect = 7.5 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = +1 Query: 151 QITETFCRKYGYSEKNNSSKPI 216 +I + Y Y+ NN+ KP+ Sbjct: 313 KIISSLSNNYNYNNYNNNYKPL 334 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 7.5 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = +1 Query: 151 QITETFCRKYGYSEKNNSSKPI 216 +I + Y Y+ NN+ KP+ Sbjct: 313 KIISSLSNNYNYNNYNNNYKPL 334 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 7.5 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = +1 Query: 151 QITETFCRKYGYSEKNNSSKPI 216 +I + Y Y+ NN+ KP+ Sbjct: 313 KIISSLSNNYNYNNYNNNYKPL 334 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 7.5 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = +1 Query: 151 QITETFCRKYGYSEKNNSSKPI 216 +I + Y Y+ NN+ KP+ Sbjct: 313 KIISSLSNNYNYNNYNNNYKPL 334 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 7.5 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = +1 Query: 151 QITETFCRKYGYSEKNNSSKPI 216 +I + Y Y+ NN+ KP+ Sbjct: 313 KIISSLSNNYNYNNYNNNYKPL 334 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.0 bits (42), Expect = 7.5 Identities = 7/22 (31%), Positives = 12/22 (54%) Frame = +1 Query: 151 QITETFCRKYGYSEKNNSSKPI 216 +I + Y Y+ NN+ KP+ Sbjct: 302 KIISSLSNNYNYNNYNNNYKPL 323 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 20.6 bits (41), Expect = 10.0 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -1 Query: 399 LLSITLAICPPIISQGYTL 343 LLS +A+ P+IS G L Sbjct: 117 LLSADVAVATPLISMGALL 135 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 20.6 bits (41), Expect = 10.0 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +1 Query: 421 DTGYGSLWLENTYNH*T 471 D G S ++ENT+ H T Sbjct: 1340 DAGEYSCYVENTFGHDT 1356 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 142,694 Number of Sequences: 438 Number of extensions: 3070 Number of successful extensions: 13 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14354847 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -