BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301A08f (429 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55246| Best HMM Match : DUF1168 (HMM E-Value=0.32) 28 3.8 SB_50778| Best HMM Match : PA14 (HMM E-Value=0.00025) 27 8.7 >SB_55246| Best HMM Match : DUF1168 (HMM E-Value=0.32) Length = 943 Score = 27.9 bits (59), Expect = 3.8 Identities = 16/31 (51%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = +3 Query: 9 CL-LLKKRHFSIMFPPKIFRGNVSTNKKSAA 98 CL LKK H IMFPPK R S + +S A Sbjct: 529 CLQALKKSHRQIMFPPKPRRPGSSPSIRSVA 559 >SB_50778| Best HMM Match : PA14 (HMM E-Value=0.00025) Length = 1266 Score = 26.6 bits (56), Expect = 8.7 Identities = 13/49 (26%), Positives = 20/49 (40%) Frame = +1 Query: 157 DSCSTWCTRAR*TIKEI*NLNRNYTFYPKCQHMHVSRTNLLH*SYFFVD 303 D+ WC A ++ + NY PK Q+ H + + FVD Sbjct: 583 DASEKWCATAMRLLQRLVGFKTNYESKPKWQYYHKISHESIEKARAFVD 631 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,499,560 Number of Sequences: 59808 Number of extensions: 198558 Number of successful extensions: 295 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 286 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 295 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 826502419 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -