BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301A08f (429 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 23 6.1 AM690372-1|CAM84316.1| 353|Anopheles gambiae purine nucleoside ... 22 8.0 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 22.6 bits (46), Expect = 6.1 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = -1 Query: 150 KLYRLYWNRSQERKLEMVL 94 K+YR W ++RK + +L Sbjct: 795 KMYRQVWVHEEDRKFQRIL 813 >AM690372-1|CAM84316.1| 353|Anopheles gambiae purine nucleoside phosphorylase protein. Length = 353 Score = 22.2 bits (45), Expect = 8.0 Identities = 10/33 (30%), Positives = 17/33 (51%) Frame = -1 Query: 234 KCIVPI*ILYFFNCLSRSCTPS*TGVNVKLYRL 136 KC +P+ +++ C T + G N K YR+ Sbjct: 160 KCAMPVRVMHLIGCTHLIATNAAGGANPK-YRV 191 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 405,195 Number of Sequences: 2352 Number of extensions: 7533 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 35292513 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -