BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301A05f (464 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z78014-1|CAB01428.1| 411|Caenorhabditis elegans Hypothetical pr... 28 2.9 Z71178-13|CAF31498.1| 342|Caenorhabditis elegans Hypothetical p... 27 8.8 >Z78014-1|CAB01428.1| 411|Caenorhabditis elegans Hypothetical protein F42E8.1 protein. Length = 411 Score = 28.3 bits (60), Expect = 2.9 Identities = 15/34 (44%), Positives = 22/34 (64%) Frame = -2 Query: 211 INNNPKIVLIQFIGKFIKFVDGSKIENKFVIIFN 110 +NN PK IQ IGK I ++GS E+ F++ +N Sbjct: 113 VNNFPKNERIQAIGKLIGHLEGS--ESLFLMAYN 144 >Z71178-13|CAF31498.1| 342|Caenorhabditis elegans Hypothetical protein B0024.13b protein. Length = 342 Score = 26.6 bits (56), Expect = 8.8 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -2 Query: 319 LK*LFFNNVLNSLCNFF 269 L+ L+FNNV N LCN F Sbjct: 134 LQMLYFNNVSNILCNHF 150 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 5,424,756 Number of Sequences: 27780 Number of extensions: 87142 Number of successful extensions: 162 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 162 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 162 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 829055604 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -