BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301A04f (385 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_1014 - 23586552-23587224,23587402-23587463,23587735-235879... 27 5.1 11_05_0085 - 18963617-18964294 26 8.9 >08_02_1014 - 23586552-23587224,23587402-23587463,23587735-23587950, 23588125-23588209,23589232-23589389,23589505-23589625, 23590081-23590243,23590330-23590415,23590660-23590742, 23590816-23591677,23593266-23593693 Length = 978 Score = 27.1 bits (57), Expect = 5.1 Identities = 12/52 (23%), Positives = 25/52 (48%) Frame = -2 Query: 228 FNFSLSSIIITVHYTKKYDQKKLFFCCSIDKIASASRSNDTSVNPVITYSHV 73 F L+S ++ ++K +K+ F C +K+ R +++P SH+ Sbjct: 470 FTRPLTSYLLGGLHSKNCSKKEWCFMCEFEKLVGEGRQGKIALSPTGILSHL 521 >11_05_0085 - 18963617-18964294 Length = 225 Score = 26.2 bits (55), Expect = 8.9 Identities = 12/52 (23%), Positives = 26/52 (50%) Frame = -1 Query: 346 EYTIDIFKRLHANIFLKISTIIKTYIV*ESTP*MLFLLQIQFFPIEYYYNGA 191 EY++ F+R +I+ ++ I E P ++ +L++ + YY N + Sbjct: 174 EYSMAYFRRTAEKTRARIAALLGMTIPFEDPPIVIHILEVSSWEARYYSNSS 225 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,774,748 Number of Sequences: 37544 Number of extensions: 140102 Number of successful extensions: 267 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 242 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 267 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 636799876 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -