BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301A04f (385 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF101319-4|AAC69352.1| 463|Caenorhabditis elegans Hypothetical ... 31 0.21 AF036703-4|AAB88555.1| 261|Caenorhabditis elegans Hypothetical ... 30 0.49 >AF101319-4|AAC69352.1| 463|Caenorhabditis elegans Hypothetical protein K08D9.2 protein. Length = 463 Score = 31.5 bits (68), Expect = 0.21 Identities = 16/42 (38%), Positives = 25/42 (59%) Frame = -2 Query: 210 SIIITVHYTKKYDQKKLFFCCSIDKIASASRSNDTSVNPVIT 85 SIIIT + +KYD L++ C +IA++S T+ V+T Sbjct: 105 SIIITKQHIEKYDVTCLYYDCKRREIANSSFPTQTAPMSVVT 146 >AF036703-4|AAB88555.1| 261|Caenorhabditis elegans Hypothetical protein T11F8.1 protein. Length = 261 Score = 30.3 bits (65), Expect = 0.49 Identities = 9/27 (33%), Positives = 19/27 (70%) Frame = -3 Query: 383 FFQWQHFRLXLFRVYYRYIQTFTC*YF 303 F+Q+ H ++ + + +Y++IQ F C +F Sbjct: 230 FWQFLHLKIKISKTFYKFIQFFKCFFF 256 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,051,001 Number of Sequences: 27780 Number of extensions: 144354 Number of successful extensions: 294 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 289 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 294 length of database: 12,740,198 effective HSP length: 74 effective length of database: 10,684,478 effective search space used: 566277334 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -