Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ovS301A04f
         (385 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ667188-1|ABG75740.1|  383|Apis mellifera histamine-gated chlor...    22   2.8  

>DQ667188-1|ABG75740.1|  383|Apis mellifera histamine-gated chloride
           channel protein.
          Length = 383

 Score = 21.8 bits (44), Expect = 2.8
 Identities = 10/44 (22%), Positives = 17/44 (38%)
 Frame = -2

Query: 252 PKCYFYYKFNFSLSSIIITVHYTKKYDQKKLFFCCSIDKIASAS 121
           P C+F      +   + I  HY   Y  K L +   +  + S +
Sbjct: 90  PDCFFKNAKKVTFHEMSIPNHYLWLYHDKTLLYMSKLTLVLSCA 133


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 101,709
Number of Sequences: 438
Number of extensions: 1776
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of database: 146,343
effective HSP length: 51
effective length of database: 124,005
effective search space used:  9424380
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)