BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS301A03f (314 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_1126 - 34284733-34284810,34285151-34285291,34285424-342855... 96 6e-21 06_01_0511 + 3688788-3688880,3689050-3689166,3689959-3690066,369... 87 3e-18 07_03_1424 - 26474464-26474514,26474549-26474635,26474905-264750... 30 0.44 09_04_0613 + 18953761-18953932,18954672-18954799,18954885-189549... 29 1.0 02_04_0481 + 23284296-23284448,23284553-23284753,23284855-232879... 29 1.0 11_06_0768 + 27129007-27129038,27129140-27129220,27129723-271300... 28 1.3 07_03_1150 - 24375859-24376050,24376173-24376283,24376488-243766... 28 1.3 03_01_0423 + 3240224-3240394,3241464-3241628,3242322-3242339,324... 28 1.3 11_06_0557 - 24955837-24956214,24957225-24957395,24957576-249576... 27 2.3 10_08_0765 - 20421813-20423174,20423591-20423771,20423862-204241... 27 2.3 07_01_0328 - 2291696-2291951,2292462-2293708 27 2.3 03_02_0348 + 7709894-7709926,7710516-7710604,7711202-7711277,771... 27 2.3 12_02_0517 - 19930197-19931585,19932064-19932253,19933887-19934044 27 4.1 02_04_0115 - 19888252-19888406,19888507-19888573,19888867-198891... 27 4.1 12_01_0926 + 9178804-9180324,9180612-9181157 26 5.4 12_01_0910 + 8858443-8859414 26 5.4 06_02_0213 + 13087707-13088423 26 5.4 11_06_0230 + 21528384-21528908,21529017-21529150,21530109-215301... 26 7.1 11_04_0143 + 14034141-14034257,14034349-14034594,14034797-14035711 26 7.1 07_01_1058 - 9292890-9293655,9293831-9294600 26 7.1 10_08_0043 - 14390398-14391531,14391850-14393691,14393800-143968... 25 9.4 10_04_0022 + 7687383-7687670,7688479-7688556,7689456-7689535,768... 25 9.4 09_02_0384 - 8294914-8297817 25 9.4 08_01_0053 + 365188-365376,365451-365729,365818-367341 25 9.4 07_03_1685 + 28645284-28645454,28645681-28647069 25 9.4 04_04_1289 + 32396945-32397073,32397154-32397333,32397444-323974... 25 9.4 01_05_0509 + 22811184-22812038,22813493-22814020 25 9.4 >02_05_1126 - 34284733-34284810,34285151-34285291,34285424-34285543, 34285787-34285874,34285962-34286080,34286437-34286628, 34286802-34286993,34287309-34287416,34287983-34288099, 34288214-34288315 Length = 418 Score = 95.9 bits (228), Expect = 6e-21 Identities = 42/85 (49%), Positives = 67/85 (78%), Gaps = 1/85 (1%) Frame = +2 Query: 59 EEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNKT 238 ++A +++ M T++IV TRLLDNE +++K E+ R + E+++ +KIKEN EKIK+NK Sbjct: 4 DDADDDQLASMSTEDIVRATRLLDNETRVLKDELQRTNLEVESYKEKIKENQEKIKLNKQ 63 Query: 239 LPYLVSNVIELLDVDPQEE-EEDGA 310 LPYLV N++E+L+++P++E EEDGA Sbjct: 64 LPYLVGNIVEILEMNPEDEAEEDGA 88 >06_01_0511 + 3688788-3688880,3689050-3689166,3689959-3690066, 3690634-3690825,3691010-3691201,3691484-3691602, 3691740-3691827,3692155-3692274,3692378-3692518, 3693065-3693142 Length = 415 Score = 87.0 bits (206), Expect = 3e-18 Identities = 42/85 (49%), Positives = 65/85 (76%), Gaps = 1/85 (1%) Frame = +2 Query: 59 EEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNKT 238 ++A +++ M T++IV +RLLDNEI+ E+ R + EL++ +KIKEN EKIK+NK Sbjct: 4 DDAEDDQLASMSTEDIVRASRLLDNEIR---DELQRTNLELESFKEKIKENQEKIKLNKQ 60 Query: 239 LPYLVSNVIELLDVDPQEE-EEDGA 310 LPYLV N++E+L+++P++E EEDGA Sbjct: 61 LPYLVGNIVEILEMNPEDEAEEDGA 85 >07_03_1424 - 26474464-26474514,26474549-26474635,26474905-26475006, 26475149-26475260,26475405-26475463,26475559-26475633, 26475734-26475832,26476128-26476343,26476426-26476500, 26476583-26476670,26476757-26476902,26477240-26477347, 26477417-26478436,26478437-26478715,26479471-26480520, 26480636-26480692,26480780-26480837,26481379-26481458, 26481598-26481654,26481764-26481833,26481967-26482202, 26482341-26482445,26482534-26482680,26482758-26482823, 26482916-26482979,26484040-26484200,26484308-26484400, 26484487-26484600,26484684-26484803,26484893-26484976, 26485061-26485216,26485389-26485811 Length = 1885 Score = 29.9 bits (64), Expect = 0.44 Identities = 22/97 (22%), Positives = 46/97 (47%), Gaps = 6/97 (6%) Frame = +2 Query: 32 EDKSIWEDGE---EALSEEVLRMPTDE---IVSRTRLLDNEIKIMKSEVMRISHELQAQN 193 E K++ ED E L E+L + + E ++S+ + L++ +KI+ + + E+ Sbjct: 1399 ETKAMLEDKSKVIEGLEHEILLLNSSEEGRLMSQIKELNDNLKIISIDKGNLEEEILKLT 1458 Query: 194 DKIKENTEKIKVNKTLPYLVSNVIELLDVDPQEEEED 304 DK++ + N+ E+ V +E+EE+ Sbjct: 1459 DKLEMAVALAEENEAASIEARQAAEISKVYAEEKEEE 1495 >09_04_0613 + 18953761-18953932,18954672-18954799,18954885-18954956, 18955033-18955146,18955547-18955615,18955691-18955747, 18956262-18956315,18956387-18956449,18956543-18956605, 18956803-18956967,18957111-18957266,18957315-18957416 Length = 404 Score = 28.7 bits (61), Expect = 1.0 Identities = 13/44 (29%), Positives = 26/44 (59%) Frame = +2 Query: 77 EVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKE 208 E L+ +DE R + ++ +K+ + E+MR+ E Q +++KE Sbjct: 161 EKLQKTSDEQKRRIQKTEHALKVAEEELMRVQLETTTQLNQLKE 204 >02_04_0481 + 23284296-23284448,23284553-23284753,23284855-23287971, 23288510-23289353,23289468-23290120,23290573-23290676, 23290898-23291000 Length = 1724 Score = 28.7 bits (61), Expect = 1.0 Identities = 14/51 (27%), Positives = 27/51 (52%) Frame = +2 Query: 53 DGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIK 205 DG ++ E+ L+ DE+ S + + + + SEV ++ H L N +I+ Sbjct: 782 DGNNSVLEK-LKQAWDELNSESENIKQALDVKNSEVDKLKHALDENNSEIE 831 >11_06_0768 + 27129007-27129038,27129140-27129220,27129723-27130089, 27130165-27130255,27130515-27130595,27130764-27131830, 27132060-27132071,27132465-27133209,27133210-27135244, 27135712-27135787,27135925-27136029,27137080-27137166 Length = 1592 Score = 28.3 bits (60), Expect = 1.3 Identities = 23/63 (36%), Positives = 35/63 (55%) Frame = +2 Query: 11 ITMATTLEDKSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQ 190 + MA +DKS + LS +V DE+++ LLDNEI+++ SE R + EL A Sbjct: 536 VVMANAQQDKSFSRN----LSLQVHVAAVDEMLN---LLDNEIQLLHSEHSR-TRELSAH 587 Query: 191 NDK 199 + K Sbjct: 588 HAK 590 >07_03_1150 - 24375859-24376050,24376173-24376283,24376488-24376655, 24376850-24377451,24377546-24377648,24378461-24378610, 24379918-24379956 Length = 454 Score = 28.3 bits (60), Expect = 1.3 Identities = 14/57 (24%), Positives = 30/57 (52%) Frame = +2 Query: 56 GEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIK 226 GE S E+ ++ R R++D+E+ S+ + E++ Q +K+K+ +I+ Sbjct: 115 GEHIHSLELKLTELEKFPERVRVIDDELMRSDSQCWLLMEEVRCQEEKLKKAALQIE 171 >03_01_0423 + 3240224-3240394,3241464-3241628,3242322-3242339, 3242494-3242836,3244138-3248540,3248928-3249107, 3249108-3250892,3251055-3252173 Length = 2727 Score = 28.3 bits (60), Expect = 1.3 Identities = 19/66 (28%), Positives = 34/66 (51%), Gaps = 5/66 (7%) Frame = +2 Query: 59 EEALSEEVLRMPTDEIVSRTRL--LDNEIKIMKSEVMRISH---ELQAQNDKIKENTEKI 223 +E L +++ R D+ + L L++E+K + V H ELQ++N +++E Sbjct: 1509 KEVLQQDLARQKEDKDILEKHLCSLEHELKAVNIRVATQQHLIEELQSKNIELEEVCNAC 1568 Query: 224 KVNKTL 241 V KTL Sbjct: 1569 DVEKTL 1574 >11_06_0557 - 24955837-24956214,24957225-24957395,24957576-24957635, 24958419-24958623,24958710-24958953,24959103-24959394, 24959734-24960828,24960915-24961409,24961665-24961823, 24961893-24962387 Length = 1197 Score = 27.5 bits (58), Expect = 2.3 Identities = 18/69 (26%), Positives = 35/69 (50%) Frame = +2 Query: 35 DKSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENT 214 D S +D + LS+ VL +I LLDNE++ + ++ + H L ++ ++E Sbjct: 190 DDSSRDDADGGLSKTVLSWTIQDI-----LLDNEVQKVPTKFKGLQHYLDVHSNLLREEV 244 Query: 215 EKIKVNKTL 241 +I + +L Sbjct: 245 -RITIKSSL 252 >10_08_0765 - 20421813-20423174,20423591-20423771,20423862-20424117, 20424768-20425095,20425218-20426156,20427015-20427761, 20428517-20428789 Length = 1361 Score = 27.5 bits (58), Expect = 2.3 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +2 Query: 41 SIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKI 145 S+W+ + LSE VL D+I+++ L D KI Sbjct: 61 SLWQWRSQGLSEVVLSWSVDQILNKDLLRDKVAKI 95 >07_01_0328 - 2291696-2291951,2292462-2293708 Length = 500 Score = 27.5 bits (58), Expect = 2.3 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = +2 Query: 128 DNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNK 235 D +++ + RIS LQ D IKE E++K NK Sbjct: 455 DIKLETCEEVAKRISEMLQGIADAIKELREEVKANK 490 >03_02_0348 + 7709894-7709926,7710516-7710604,7711202-7711277, 7712019-7712214,7712449-7712832,7712884-7714804, 7714906-7714966,7715952-7716371 Length = 1059 Score = 27.5 bits (58), Expect = 2.3 Identities = 16/69 (23%), Positives = 36/69 (52%), Gaps = 3/69 (4%) Frame = +2 Query: 29 LEDKSIWEDGEEALSEEVLRMPTDE---IVSRTRLLDNEIKIMKSEVMRISHELQAQNDK 199 L K + + +L+E L+ + + SR L+NEIK+++S++ ++ EL + Sbjct: 824 LTSKLVASEKSNSLAETQLKCMAESYKSLESRKAELENEIKVLQSKIEVLTAELDDERQN 883 Query: 200 IKENTEKIK 226 +E+ + + Sbjct: 884 HQEDITRYR 892 >12_02_0517 - 19930197-19931585,19932064-19932253,19933887-19934044 Length = 578 Score = 26.6 bits (56), Expect = 4.1 Identities = 18/71 (25%), Positives = 35/71 (49%) Frame = +2 Query: 47 WEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIK 226 WE+GE A ++ +R+ ++ I ++DN++ + R+ E + N + + Sbjct: 247 WEEGEHAHVDDHMRLMSNSIYYDLLIVDNQVPFF--VLARLFEEFRRYNGE----HPIVL 300 Query: 227 VNKTLPYLVSN 259 VN L L+SN Sbjct: 301 VNTPLVNLISN 311 >02_04_0115 - 19888252-19888406,19888507-19888573,19888867-19889101, 19889179-19889255,19889350-19889415,19889517-19889565, 19889651-19889701,19889799-19889851,19889973-19890024, 19890126-19890214,19890308-19890393,19890603-19890659, 19890742-19890919,19891852-19891908,19892209-19892439 Length = 500 Score = 26.6 bits (56), Expect = 4.1 Identities = 11/34 (32%), Positives = 23/34 (67%) Frame = +2 Query: 125 LDNEIKIMKSEVMRISHELQAQNDKIKENTEKIK 226 LDN + +++EV +S + QA +++I + EK++ Sbjct: 242 LDNGLSALQAEVENLSLKEQALDERISDMREKLR 275 >12_01_0926 + 9178804-9180324,9180612-9181157 Length = 688 Score = 26.2 bits (55), Expect = 5.4 Identities = 12/37 (32%), Positives = 23/37 (62%), Gaps = 3/37 (8%) Frame = +2 Query: 125 LDNEIKIMKSEVMRISHE---LQAQNDKIKENTEKIK 226 L+N + MK + ++ E ++ +N+K+KE EK+K Sbjct: 494 LNNLTEAMKDVLPKVKEENEKVKEENEKVKEQDEKVK 530 >12_01_0910 + 8858443-8859414 Length = 323 Score = 26.2 bits (55), Expect = 5.4 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = -2 Query: 169 DPHHFALHYFDFIVQKSGSTYDFISWHAKNFLTESFLAILP 47 DP L + D + + +T I+ H+++FL S L +LP Sbjct: 23 DPSPAVLPWPDLLAGAAAATRRLIAAHSRHFLALSSLLLLP 63 >06_02_0213 + 13087707-13088423 Length = 238 Score = 26.2 bits (55), Expect = 5.4 Identities = 15/52 (28%), Positives = 29/52 (55%), Gaps = 3/52 (5%) Frame = +2 Query: 146 MKSEVMRISHELQAQNDKIK---ENTEKIKVNKTLPYLVSNVIELLDVDPQE 292 + + + + ++LQAQN+K+K E +K K + +L S V ++ D +E Sbjct: 98 LNQQHIELQNQLQAQNEKMKALQEVAKKESGGKVMGWLNSKVEDICQEDLEE 149 >11_06_0230 + 21528384-21528908,21529017-21529150,21530109-21530158, 21530194-21530726 Length = 413 Score = 25.8 bits (54), Expect = 7.1 Identities = 14/56 (25%), Positives = 25/56 (44%) Frame = +2 Query: 128 DNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNKTLPYLVSNVIELLDVDPQEE 295 DN K+ S + ++H+ A N I+ +K +P ++ + LL P E Sbjct: 285 DNSKKLFYSRMFGVNHKDAADNQSIEVTKNILKKCGGVPLSITTIASLLIDKPMGE 340 >11_04_0143 + 14034141-14034257,14034349-14034594,14034797-14035711 Length = 425 Score = 25.8 bits (54), Expect = 7.1 Identities = 19/78 (24%), Positives = 40/78 (51%), Gaps = 3/78 (3%) Frame = +2 Query: 41 SIWEDGEEALSEEVLRMPTDE--IVSRTRLLDNEIKIM-KSEVMRISHELQAQNDKIKEN 211 ++W +E + + + +P +E I S+ + + KI + +V+ ELQ DKI++ Sbjct: 180 ALWNKEDEEMKKAGVPVPMEEWNIQSKHWVKERTPKITSEGKVLFEDPELQGVADKIEDL 239 Query: 212 TEKIKVNKTLPYLVSNVI 265 + K K + +P +V+ Sbjct: 240 SSKEKKGEFIPQREKDVL 257 >07_01_1058 - 9292890-9293655,9293831-9294600 Length = 511 Score = 25.8 bits (54), Expect = 7.1 Identities = 14/30 (46%), Positives = 20/30 (66%) Frame = +2 Query: 53 DGEEALSEEVLRMPTDEIVSRTRLLDNEIK 142 DG+ AL E+ MPTD+I ++T LD I+ Sbjct: 462 DGDMALPEQ---MPTDQISNQTEGLDQYIQ 488 >10_08_0043 - 14390398-14391531,14391850-14393691,14393800-14396825, 14397510-14397609 Length = 2033 Score = 25.4 bits (53), Expect = 9.4 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +2 Query: 134 EIKIMKSEVMRISHELQAQNDKIKENTEKIKVN 232 E+ + EV R++ E+Q N+K+ E ++ KVN Sbjct: 353 ELAQCQEEVQRLTKEIQMANEKLNE-LKQTKVN 384 >10_04_0022 + 7687383-7687670,7688479-7688556,7689456-7689535, 7689876-7690095,7690444-7690677 Length = 299 Score = 25.4 bits (53), Expect = 9.4 Identities = 17/68 (25%), Positives = 38/68 (55%), Gaps = 2/68 (2%) Frame = +2 Query: 104 IVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIK--VNKTLPYLVSNVIELLD 277 +V+R R + E+K+++ E+ R E +N + + N+E IK + + + + + + +D Sbjct: 146 LVNR-RQKEAELKLLEEELARRVEESIRKNVEDRLNSEDIKNEIKRRVEEGIKQLFDEVD 204 Query: 278 VDPQEEEE 301 Q+E+E Sbjct: 205 AQLQKEKE 212 >09_02_0384 - 8294914-8297817 Length = 967 Score = 25.4 bits (53), Expect = 9.4 Identities = 22/69 (31%), Positives = 38/69 (55%), Gaps = 3/69 (4%) Frame = +2 Query: 11 ITMATTLEDKSIWEDGEEALSEEVLRMPTDEIVSRTRLLD-NEIKIMKS--EVMRISHEL 181 IT+ ++ K W + E ALS DE T+LL+ +E+K++ +RIS++ Sbjct: 345 ITVGRSMRAKRTWREWENALS------TFDE---STQLLEASEMKVINPILSTLRISYD- 394 Query: 182 QAQNDKIKE 208 +ND++KE Sbjct: 395 NLENDQLKE 403 >08_01_0053 + 365188-365376,365451-365729,365818-367341 Length = 663 Score = 25.4 bits (53), Expect = 9.4 Identities = 14/65 (21%), Positives = 33/65 (50%) Frame = +2 Query: 32 EDKSIWEDGEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKEN 211 E+ +W+D E++ + L++ + + + I ++ SEV+ S E+ A+ Sbjct: 422 EEPELWKDEHESVEIDELKVQMENSATECEQWKDGISVLGSEVID-SVEIVAKEQDSAIE 480 Query: 212 TEKIK 226 +E++K Sbjct: 481 SEQLK 485 >07_03_1685 + 28645284-28645454,28645681-28647069 Length = 519 Score = 25.4 bits (53), Expect = 9.4 Identities = 17/82 (20%), Positives = 36/82 (43%), Gaps = 2/82 (2%) Frame = +2 Query: 62 EALSEEVLRMPTDEIVSRTRLLDNE--IKIMKSEVMRISHELQAQNDKIKENTEKIKVNK 235 E+L E+ + SR ++ N I ++ E+ R +H+LQ ND+ + + + Sbjct: 176 ESLCNEIAKEKILVERSREKVCSNTSLISSLEGELDRTTHKLQTLNDRQRRREDSSHILM 235 Query: 236 TLPYLVSNVIELLDVDPQEEEE 301 + + S + +L + E Sbjct: 236 EIKKVTSEIEQLKSASNASKSE 257 >04_04_1289 + 32396945-32397073,32397154-32397333,32397444-32397477, 32397665-32397720,32397994-32398089,32398194-32398258, 32398364-32398437,32398524-32398648 Length = 252 Score = 25.4 bits (53), Expect = 9.4 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +2 Query: 5 HNITMATTLEDKSIWEDGEEALS 73 HN T T +D S W D E+ LS Sbjct: 161 HNFTTGTWSDDVSSWGDCEDLLS 183 >01_05_0509 + 22811184-22812038,22813493-22814020 Length = 460 Score = 25.4 bits (53), Expect = 9.4 Identities = 16/75 (21%), Positives = 34/75 (45%) Frame = +2 Query: 56 GEEALSEEVLRMPTDEIVSRTRLLDNEIKIMKSEVMRISHELQAQNDKIKENTEKIKVNK 235 GE+ ++ L +PT ++ +R +L I + + I A +K+ T+ ++N+ Sbjct: 310 GEDVQAQVTLSLPTGKLYTRIAILTTLITPLAKYALVIQPVTIAIEEKLSATTD-AEINR 368 Query: 236 TLPYLVSNVIELLDV 280 L S + + V Sbjct: 369 LTRVLTSTAVVISTV 383 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,017,183 Number of Sequences: 37544 Number of extensions: 89037 Number of successful extensions: 328 Number of sequences better than 10.0: 27 Number of HSP's better than 10.0 without gapping: 318 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 325 length of database: 14,793,348 effective HSP length: 72 effective length of database: 12,090,180 effective search space used: 386885760 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -